Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2224
Gene name
LocationContig_1773:21..2275
Strand+
Gene length (bp)2254
Transcript length (bp)2115
Coding sequence length (bp)2115
Protein length (aa) 705

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02204 VPS9 Vacuolar sorting protein 9 (VPS9) domain 4.4E-25 270 370

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94388|VPS92_SCHPO Vacuolar protein sorting-associated protein 9b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps902 PE=1 SV=1 80 366 2.0E-16
sp|Q9LT31|VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana GN=VPS9A PE=1 SV=1 202 455 1.0E-12
sp|Q9UJ41|RABX5_HUMAN Rab5 GDP/GTP exchange factor OS=Homo sapiens GN=RABGEF1 PE=1 SV=2 204 374 1.0E-08
sp|O74396|VPS91_SCHPO Vacuolar protein sorting-associated protein 9a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps901 PE=1 SV=3 284 374 2.0E-08
sp|P54787|VPS9_YEAST Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS9 PE=1 SV=2 201 379 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94388|VPS92_SCHPO Vacuolar protein sorting-associated protein 9b OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps902 PE=1 SV=1 80 366 2.0E-16
sp|Q9LT31|VPS9A_ARATH Vacuolar protein sorting-associated protein 9A OS=Arabidopsis thaliana GN=VPS9A PE=1 SV=1 202 455 1.0E-12
sp|Q9UJ41|RABX5_HUMAN Rab5 GDP/GTP exchange factor OS=Homo sapiens GN=RABGEF1 PE=1 SV=2 204 374 1.0E-08
sp|O74396|VPS91_SCHPO Vacuolar protein sorting-associated protein 9a OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps901 PE=1 SV=3 284 374 2.0E-08
sp|P54787|VPS9_YEAST Vacuolar protein sorting-associated protein 9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS9 PE=1 SV=2 201 379 1.0E-07
sp|Q9JM13|RABX5_MOUSE Rab5 GDP/GTP exchange factor OS=Mus musculus GN=Rabgef1 PE=1 SV=1 204 386 2.0E-07
sp|O18973|RABX5_BOVIN Rab5 GDP/GTP exchange factor OS=Bos taurus GN=RABGEF1 PE=1 SV=1 183 374 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2224
MLVLFSLQRLMASPAFATSASPSFPQPPRRDSDVVAAPKRAHSFANRPQRSDAPDAFDTRDTLDIDHGADGPRAS
VDLDDLPIELISLTDSFLDSLDAKVHPTPPNIERLSQLFQEFYTLAASHIATHTNALATRQSREASAPPASSISS
AASRLRSKASAFGSRDRWPRHDIDQQMITADELASRKRARKALESKRVLLEEAVERRLCQGIYDRIYRHRSTQDE
AQDDKLRSKTAALALVGINLADLGVDLGPDASSNSDTRVRQWLHHARANLTEMSQSRYPLGKLNHLKAAHKSIVD
TLAHFHPSASADEVMPMLIYTLITMPPEGLHIISDVHFVQNFRWEPKLTGEAAYCLTNLEAAISFLQNVDLATLR
EDEHPSGPPKAPPSHAATPRAETFPPAYNQGPAPRPRSDSLQPPKTASTPSTTPSTPGLKAPDPDLPKRRRLSDL
VNTPAQAIGAASDAVISTADQGLKTISSSLGDSYSFLLGKLRERHTGPKEALVPRTLDDARKLVSTPPPTDDDDT
TSVDDADATADPKPPSARGGDRVLGIIAGRRDPSVDSSRSASSSSKKVPVPQNPNKPPPTSTSTPAPAVLDQVRN
LGSSFNPMARLSNIGGFRPFARTPSASTPAKDIGPTADGGDLASAFPDIAAALPPKPTPRLAPPVRRFIEMQSPG
DLRLGDVIDLLRDYRRLAGALKDMGAFDD*
Coding >OphauG2|2224
ATGCTAGTCCTCTTCTCGCTCCAGCGCCTCATGGCTTCCCCGGCCTTTGCCACCTCGGCCTCCCCCTCGTTCCCG
CAGCCTCCGAGACGAGACAGCGACGTCGTGGCAGCCCCCAAGCGCGCCCACAGCTTTGCCAACCGCCCCCAGCGC
AGTGACGCTCCCGATGCCTTTGACACGAGGGACACGCTCGACATTGACCATGGGGCAGACGGCCCGCGGGCCTCG
GTCGATCTCGACGACCTCCCCATTGAGCTCATCAGCCTGACGGACAGCTTCCTCGACTCGCTCGACGCAAAAGTC
CACCCCACGCCCCCAAACATTGAACGACTGTCCCAGCTCTTCCAAGAGTTCTACACCCTCGCCGCTTCCCACATC
GCCACCCACACAAACGCCCTGGCCACGCGCCAGAGCCGCGAGGCTTCCGCGCCCCCCGCCTCGTCCATCTCGTCG
GCCGCCAGCCGCCTGCGGTCCAAGGCCTCGGCCTTTGGCTCCAGGGACCGATGGCCCAGACACGACATTGACCAG
CAGATGATTACGGCCGACGAGCTGGCCAGCCGGAAGCGCGCCCGAAAGGCTCTCGAGTCCAAGCGAGTCCTGCTG
GAGGAGGCGGTCGAACGCAGGCTCTGCCAGGGCATCTACGACCGCATCTACCGCCACCGCAGCACCCAGGACGAG
GCCCAGGACGACAAGCTGCGCTCCAAGACAGCGGCCCTTGCCCTCGTCGGCATCAACCTGGCCGACCTGGGCGTC
GACCTTGGCCCCGACGCCTCGTCCAACTCGGACACAAGGGTGCGCCAATGGCTGCACCACGCCCGCGCCAACCTG
ACGGAAATGAGCCAGTCGAGATATCCCCTCGGCAAGCTCAACCACCTCAAGGCCGCGCACAAGAGCATCGTCGAC
ACCCTGGCCCATTTCCACCCCTCGGCCTCGGCCGACGAGGTGATGCCCATGCTCATCTACACCCTCATCACCATG
CCGCCCGAGGGCCTCCACATCATCAGCGATGTCCACTTTGTCCAAAACTTCCGGTGGGAGCCCAAGCTCACCGGC
GAGGCCGCCTACTGCCTGACCAACCTCGAGGCCGCCATCAGCTTCCTGCAAAACGTCGACCTGGCCACGCTGCGC
GAAGACGAGCATCCCTCGGGCCCGCCAAAGGCCCCGCCGTCGCACGCGGCAACGCCCCGCGCCGAGACCTTCCCC
CCCGCCTACAACCAAGGCCCGGCCCCTCGCCCCAGAAGCGACAGCCTCCAGCCGCCCAAAACCGCCTCTACTCCC
TCCACCACGCCCTCCACCCCGGGCCTCAAAGCCCCCGACCCAGACCTGCCCAAGCGCCGCCGCCTCAGCGACTTG
GTCAACACCCCCGCCCAGGCCATTGGAGCTGCCAGCGACGCCGTCATCAGCACCGCCGACCAGGGCCTCAAGACC
ATCTCCAGCAGCCTCGGCGACAGCTACTCCTTTCTCCTCGGCAAGCTGCGCGAGCGCCACACCGGCCCCAAGGAA
GCCCTGGTGCCGCGCACCCTCGACGACGCCCGCAAGCTCGTCAGCACCCCGCCGCCCACGGATGACGATGACACC
ACCAGCGTCGACGACGCCGATGCCACTGCCGACCCCAAACCTCCTTCGGCCCGCGGCGGCGACAGGGTCCTCGGC
ATCATTGCCGGCCGCCGAGACCCCAGCGTCGACAGTTCCCGCAGCGCCAGCTCCTCTTCTAAAAAGGTGCCCGTG
CCTCAGAATCCCAACAAGCCGCCCCCCACCTCCACCTCCACTCCTGCTCCCGCCGTCCTCGACCAGGTCCGCAAT
CTCGGCAGCTCCTTCAACCCCATGGCCCGTCTGTCCAACATTGGCGGCTTCAGGCCCTTTGCCCGCACTCCCTCG
GCCTCGACCCCTGCAAAGGACATTGGGCCAACCGCAGACGGCGGTGACTTGGCATCGGCCTTTCCCGACATTGCC
GCCGCCCTGCCTCCCAAACCCACTCCACGCCTCGCCCCGCCTGTCCGCCGCTTCATCGAGATGCAGAGCCCTGGC
GACCTGCGTCTGGGCGACGTTATTGACCTCCTTCGAGACTATCGCCGCCTTGCTGGCGCTCTCAAAGACATGGGT
GCCTTTGACGATTGA
Transcript >OphauG2|2224
ATGCTAGTCCTCTTCTCGCTCCAGCGCCTCATGGCTTCCCCGGCCTTTGCCACCTCGGCCTCCCCCTCGTTCCCG
CAGCCTCCGAGACGAGACAGCGACGTCGTGGCAGCCCCCAAGCGCGCCCACAGCTTTGCCAACCGCCCCCAGCGC
AGTGACGCTCCCGATGCCTTTGACACGAGGGACACGCTCGACATTGACCATGGGGCAGACGGCCCGCGGGCCTCG
GTCGATCTCGACGACCTCCCCATTGAGCTCATCAGCCTGACGGACAGCTTCCTCGACTCGCTCGACGCAAAAGTC
CACCCCACGCCCCCAAACATTGAACGACTGTCCCAGCTCTTCCAAGAGTTCTACACCCTCGCCGCTTCCCACATC
GCCACCCACACAAACGCCCTGGCCACGCGCCAGAGCCGCGAGGCTTCCGCGCCCCCCGCCTCGTCCATCTCGTCG
GCCGCCAGCCGCCTGCGGTCCAAGGCCTCGGCCTTTGGCTCCAGGGACCGATGGCCCAGACACGACATTGACCAG
CAGATGATTACGGCCGACGAGCTGGCCAGCCGGAAGCGCGCCCGAAAGGCTCTCGAGTCCAAGCGAGTCCTGCTG
GAGGAGGCGGTCGAACGCAGGCTCTGCCAGGGCATCTACGACCGCATCTACCGCCACCGCAGCACCCAGGACGAG
GCCCAGGACGACAAGCTGCGCTCCAAGACAGCGGCCCTTGCCCTCGTCGGCATCAACCTGGCCGACCTGGGCGTC
GACCTTGGCCCCGACGCCTCGTCCAACTCGGACACAAGGGTGCGCCAATGGCTGCACCACGCCCGCGCCAACCTG
ACGGAAATGAGCCAGTCGAGATATCCCCTCGGCAAGCTCAACCACCTCAAGGCCGCGCACAAGAGCATCGTCGAC
ACCCTGGCCCATTTCCACCCCTCGGCCTCGGCCGACGAGGTGATGCCCATGCTCATCTACACCCTCATCACCATG
CCGCCCGAGGGCCTCCACATCATCAGCGATGTCCACTTTGTCCAAAACTTCCGGTGGGAGCCCAAGCTCACCGGC
GAGGCCGCCTACTGCCTGACCAACCTCGAGGCCGCCATCAGCTTCCTGCAAAACGTCGACCTGGCCACGCTGCGC
GAAGACGAGCATCCCTCGGGCCCGCCAAAGGCCCCGCCGTCGCACGCGGCAACGCCCCGCGCCGAGACCTTCCCC
CCCGCCTACAACCAAGGCCCGGCCCCTCGCCCCAGAAGCGACAGCCTCCAGCCGCCCAAAACCGCCTCTACTCCC
TCCACCACGCCCTCCACCCCGGGCCTCAAAGCCCCCGACCCAGACCTGCCCAAGCGCCGCCGCCTCAGCGACTTG
GTCAACACCCCCGCCCAGGCCATTGGAGCTGCCAGCGACGCCGTCATCAGCACCGCCGACCAGGGCCTCAAGACC
ATCTCCAGCAGCCTCGGCGACAGCTACTCCTTTCTCCTCGGCAAGCTGCGCGAGCGCCACACCGGCCCCAAGGAA
GCCCTGGTGCCGCGCACCCTCGACGACGCCCGCAAGCTCGTCAGCACCCCGCCGCCCACGGATGACGATGACACC
ACCAGCGTCGACGACGCCGATGCCACTGCCGACCCCAAACCTCCTTCGGCCCGCGGCGGCGACAGGGTCCTCGGC
ATCATTGCCGGCCGCCGAGACCCCAGCGTCGACAGTTCCCGCAGCGCCAGCTCCTCTTCTAAAAAGGTGCCCGTG
CCTCAGAATCCCAACAAGCCGCCCCCCACCTCCACCTCCACTCCTGCTCCCGCCGTCCTCGACCAGGTCCGCAAT
CTCGGCAGCTCCTTCAACCCCATGGCCCGTCTGTCCAACATTGGCGGCTTCAGGCCCTTTGCCCGCACTCCCTCG
GCCTCGACCCCTGCAAAGGACATTGGGCCAACCGCAGACGGCGGTGACTTGGCATCGGCCTTTCCCGACATTGCC
GCCGCCCTGCCTCCCAAACCCACTCCACGCCTCGCCCCGCCTGTCCGCCGCTTCATCGAGATGCAGAGCCCTGGC
GACCTGCGTCTGGGCGACGTTATTGACCTCCTTCGAGACTATCGCCGCCTTGCTGGCGCTCTCAAAGACATGGGT
GCCTTTGACGATTGA
Gene >OphauG2|2224
ATGCTAGTCCTCTTCTCGCTCCAGCGCCTCATGGCTTCCCCGGCCTTTGCCACCTCGGCCTCCCCCTCGTTCCCG
CAGCCTCCGAGACGAGACAGCGACGTCGTGGCAGCCCCCAAGCGCGCCCACAGCTTTGCCAACCGCCCCCAGCGC
AGTGACGCTCCCGATGCCTTTGACACGAGGGACACGCTCGACATTGACCATGGGGCAGACGGCCCGCGGGCCTCG
GTCGATCTCGACGACCTCCCCATTGAGCTCATCAGCCTGACGGACAGGTAGGCCCGCTGGCTGACCTTGCTCGTC
TTCGTCTTGGGGCTGACTGACGCCCCGACGCCCCAGCTTCCTCGACTCGCTCGACGCAAAAGTCCACCCCACGCC
CCCAAACATTGAACGACTGTCCCAGCTCTTCCAAGAGTTCTACACCCTCGCCGCTTCCCACATCGCCACCCACAC
AAACGCCCTGGCCACGCGCCAGAGCCGCGAGGCTTCCGCGCCCCCCGCCTCGTCCATCTCGTCGGCCGCCAGCCG
CCTGCGGTCCAAGGCCTCGGCCTTTGGCTCCAGGGACCGATGGCCCAGACACGACATTGACCAGCAGATGATTAC
GGCCGACGAGCTGGCCAGCCGGAAGCGCGCCCGAAAGGCTCTCGAGTCCAAGCGAGTCCTGCTGGAGGAGGCGGT
CGAACGCAGGCTCTGCCAGGGCATCTACGACCGCATCTACCGCCACCGCAGCACCCAGGACGAGGCCCAGGACGA
CAAGCTGCGCTCCAAGACAGCGGCCCTTGCCCTCGTCGGCATCAACCTGGCCGACCTGGGCGTCGACCTTGGCCC
CGACGCCTCGTCCAACTCGGACACAAGGGTGCGCCAATGGCTGCACCACGCCCGCGCCAACCTGACGGAAATGAG
CCAGTCGAGATATCCCCTCGGCAAGCTCAACCACCTCAAGGCCGCGCACAAGAGCATCGTCGACACCCTGGCCCA
TTTCCACCCCTCGGCCTCGGCCGACGAGGTGATGCCCATGCTCATCTACACCCTCATCACCATGCCGCCCGAGGG
CCTCCACATCATCAGCGATGTCCACTTTGTCCAAAACTTCCGGTGGGAGCCCAAGCTCACCGGCGAGGCCGCCTA
CTGCCTGACCAACCTCGAGGCCGCCATCAGCTTCCTGCAAAACGTCGACCTGGCCACGCTGCGCGAAGACGAGCA
TCCCTCGGGCCCGCCAAAGGCCCCGCCGTCGCACGCGGCAACGCCCCGCGCCGAGACCTTCCCCCCCGCCTACAA
CCAAGGCCCGGCCCCTCGCCCCAGAAGCGACAGCCTCCAGCCGCCCAAAACCGCCTCTACTCCCTCCACCACGCC
CTCCACCCCGGGCCTCAAAGCCCCCGACCCAGACCTGCCCAAGCGCCGCCGCCTCAGCGACTTGGTCAACACCCC
CGCCCAGGCCATTGGAGCTGCCAGCGACGCCGTCATCAGCACCGCCGACCAGGGCCTCAAGACCATCTCCAGCAG
CCTCGGCGACAGCTACTCCTTTCTCCTCGGCAAGCTGCGCGAGCGCCACACCGGCCCCAAGGAAGCCCTGGTGCC
GCGCACCCTCGACGACGCCCGCAAGCTCGTCAGCACCCCGCCGCCCACGGATGACGATGACACCACCAGCGTCGA
CGACGCCGATGCCACTGCCGACCCCAAACCTCCTTCGGCCCGCGGCGGCGACAGGGTCCTCGGCATCATTGCCGG
CCGCCGAGACCCCAGCGTCGACAGTTCCCGCAGCGCCAGCTCCTCTTCTAAAAAGGTGCCCGTGCCTCAGAATCC
CAACAAGCCGCCCCCCACCTCCACCTCCACTCCTGCTCCCGCCGTCCTCGACCAGGTCCGCAATCTCGGCAGCTC
CTTCAACCCCATGGCCCGTCTGTCCAACATTGGCGGCTTCAGGCCCTTTGCCCGCACTCCCTCGGCCTCGACCCC
TGCAAAGGACATTGGGCCAACCGCAGACGGCGGTGACTTGGCATCGGTACTTGCTTGCCCTTTTTCCATTCCCCA
TCCCCCCGTGGCCCCCATCTTGCTTTTCTAACAAAACTCTCCCAAGGCCTTTCCCGACATTGCCGCCGCCCTGCC
TCCCAAACCCACTCCACGCCTCGCCCCGCCTGTCCGCCGCTTCATCGAGATGCAGAGCCCTGGCGACCTGCGTCT
GGGCGACGTTATTGACCTCCTTCGAGACTATCGCCGCCTTGCTGGCGCTCTCAAAGACATGGGTGCCTTTGACGA
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail