Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2222
Gene name
LocationContig_1771:520..2024
Strand-
Gene length (bp)1504
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 2.8E-27 7 215

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9MAA2|AT74_ARATH Phosphoglycerate mutase-like protein AT74 OS=Arabidopsis thaliana GN=At3g05170 PE=2 SV=1 4 223 7.0E-48
sp|Q99288|DET1_YEAST Broad-range acid phosphatase DET1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DET1 PE=1 SV=1 2 225 4.0E-46
sp|O04035|AT74H_ARATH Phosphoglycerate mutase-like protein AT74H OS=Arabidopsis thaliana GN=At1g08940 PE=3 SV=2 4 273 1.0E-45
sp|P36136|SHB17_YEAST Sedoheptulose 1,7-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHB17 PE=1 SV=1 4 198 4.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2260
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2222 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2367
Ophiocordyceps camponoti-floridani Ophcf2|05708
Ophiocordyceps camponoti-rufipedis Ophun1|2363
Ophiocordyceps kimflemingae Ophio5|6465
Ophiocordyceps subramaniannii Hirsu2|2937

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2222
MAKPRLIILVRHAQSEGNKNRAIHQTVPDHRVKLTPEGCLQAADAGRRLRSLLRPDDSLQIFTSPYRRTRETTDG
IIETLTSDDPEPSPFRRADIKVYEEPRLREQDFGNFQPCSAEMERMWQERADYGHFFYRIPNGESAADAYDRISG
FNESLWRQFGDDDFPSVCILVTHGLMSRVFLMKWYHFTVEYFEDLRNVNHCEFLIMRHEDNGKYLLENKLRTWSE
LRRERAQASTKEERAKLDGPRAAAAMRRWGGCPNGCNHSSHYKKYHDLDSLRQRDSDPMPNASGNASSSSNDAMT
IASRRLRLHRPTTSDDGDDEQSDRPRVPVAVAVQVSSHNVREEELSSPDGTPSFITAEDRLRSRKSPHLHVHLGR
DFGGTYSGHASVAGSETDGVTDCDSDRDPATASGTRPRGRRCVFANRLGDEDTDGEQSADGEPPSALHKDLERAE
KEDRSIAGSVY*
Coding >OphauG2|2222
ATGGCTAAGCCACGCCTCATTATCCTCGTTCGACATGCCCAGTCTGAAGGCAACAAAAATCGTGCAATCCACCAA
ACAGTGCCTGACCATCGCGTCAAGTTGACTCCCGAGGGCTGTCTACAGGCTGCCGATGCTGGCCGCCGCCTGCGA
AGCCTCCTGCGCCCCGACGATAGTCTCCAAATCTTCACTTCGCCATACCGTCGCACGCGTGAAACGACGGACGGC
ATCATCGAAACCTTGACATCTGACGACCCCGAACCCTCGCCCTTTCGCCGTGCCGACATCAAGGTCTATGAGGAG
CCGCGTCTGCGAGAACAAGACTTTGGCAACTTCCAGCCTTGTAGCGCAGAGATGGAGCGCATGTGGCAGGAGAGG
GCAGACTACGGCCACTTCTTCTATCGCATTCCCAATGGCGAGAGCGCTGCCGATGCCTACGACCGCATCAGCGGC
TTCAACGAGAGTCTGTGGCGCCAGTTTGGCGACGATGACTTTCCCAGCGTCTGCATTCTCGTCACTCATGGTCTC
ATGTCGCGCGTCTTTCTCATGAAGTGGTATCACTTCACCGTCGAGTACTTTGAGGATTTGCGCAATGTCAACCAC
TGCGAGTTCCTCATTATGCGCCACGAGGACAATGGAAAGTACCTGCTCGAGAACAAGCTGCGGACTTGGTCTGAG
CTGCGCCGCGAACGCGCCCAGGCCAGCACCAAGGAGGAACGGGCAAAACTCGATGGCCCCAGGGCAGCTGCTGCC
ATGCGCCGCTGGGGAGGCTGTCCCAACGGGTGCAACCACTCGAGTCACTACAAAAAGTACCACGACCTTGATTCC
TTGCGCCAGCGTGACAGCGATCCCATGCCAAACGCCAGCGGCAATGCTAGCAGCAGTAGCAACGACGCCATGACC
ATTGCCAGCCGGAGACTTCGTCTTCATCGCCCCACGACATCTGACGACGGCGATGACGAGCAGAGCGATCGGCCG
CGCGTCCCGGTGGCCGTGGCTGTTCAAGTCTCGTCGCACAATGTCCGCGAAGAAGAGCTGTCGTCGCCCGACGGC
ACGCCCTCCTTCATCACCGCCGAAGACCGGCTGCGCAGCCGCAAGTCTCCCCACTTGCACGTGCACCTTGGCCGC
GACTTTGGCGGCACCTATTCGGGCCACGCCTCGGTTGCCGGCAGCGAAACCGACGGCGTCACCGACTGCGATAGT
GACCGGGATCCCGCCACGGCCAGCGGCACTCGTCCCCGTGGCCGTCGCTGCGTCTTTGCAAACCGCCTCGGCGAC
GAGGATACGGATGGCGAGCAGTCAGCAGATGGAGAGCCGCCTAGTGCGCTGCACAAAGACTTGGAAAGGGCTGAG
AAGGAAGACCGCAGCATTGCCGGAAGTGTCTATTAA
Transcript >OphauG2|2222
ATGGCTAAGCCACGCCTCATTATCCTCGTTCGACATGCCCAGTCTGAAGGCAACAAAAATCGTGCAATCCACCAA
ACAGTGCCTGACCATCGCGTCAAGTTGACTCCCGAGGGCTGTCTACAGGCTGCCGATGCTGGCCGCCGCCTGCGA
AGCCTCCTGCGCCCCGACGATAGTCTCCAAATCTTCACTTCGCCATACCGTCGCACGCGTGAAACGACGGACGGC
ATCATCGAAACCTTGACATCTGACGACCCCGAACCCTCGCCCTTTCGCCGTGCCGACATCAAGGTCTATGAGGAG
CCGCGTCTGCGAGAACAAGACTTTGGCAACTTCCAGCCTTGTAGCGCAGAGATGGAGCGCATGTGGCAGGAGAGG
GCAGACTACGGCCACTTCTTCTATCGCATTCCCAATGGCGAGAGCGCTGCCGATGCCTACGACCGCATCAGCGGC
TTCAACGAGAGTCTGTGGCGCCAGTTTGGCGACGATGACTTTCCCAGCGTCTGCATTCTCGTCACTCATGGTCTC
ATGTCGCGCGTCTTTCTCATGAAGTGGTATCACTTCACCGTCGAGTACTTTGAGGATTTGCGCAATGTCAACCAC
TGCGAGTTCCTCATTATGCGCCACGAGGACAATGGAAAGTACCTGCTCGAGAACAAGCTGCGGACTTGGTCTGAG
CTGCGCCGCGAACGCGCCCAGGCCAGCACCAAGGAGGAACGGGCAAAACTCGATGGCCCCAGGGCAGCTGCTGCC
ATGCGCCGCTGGGGAGGCTGTCCCAACGGGTGCAACCACTCGAGTCACTACAAAAAGTACCACGACCTTGATTCC
TTGCGCCAGCGTGACAGCGATCCCATGCCAAACGCCAGCGGCAATGCTAGCAGCAGTAGCAACGACGCCATGACC
ATTGCCAGCCGGAGACTTCGTCTTCATCGCCCCACGACATCTGACGACGGCGATGACGAGCAGAGCGATCGGCCG
CGCGTCCCGGTGGCCGTGGCTGTTCAAGTCTCGTCGCACAATGTCCGCGAAGAAGAGCTGTCGTCGCCCGACGGC
ACGCCCTCCTTCATCACCGCCGAAGACCGGCTGCGCAGCCGCAAGTCTCCCCACTTGCACGTGCACCTTGGCCGC
GACTTTGGCGGCACCTATTCGGGCCACGCCTCGGTTGCCGGCAGCGAAACCGACGGCGTCACCGACTGCGATAGT
GACCGGGATCCCGCCACGGCCAGCGGCACTCGTCCCCGTGGCCGTCGCTGCGTCTTTGCAAACCGCCTCGGCGAC
GAGGATACGGATGGCGAGCAGTCAGCAGATGGAGAGCCGCCTAGTGCGCTGCACAAAGACTTGGAAAGGGCTGAG
AAGGAAGACCGCAGCATTGCCGGAAGTGTCTATTAA
Gene >OphauG2|2222
ATGGCTAAGCCACGCCTCATTATCCTCGTTCGACATGCCCAGTCTGAAGGCAACAGTGCGTCTCGAGTATCCTGT
CACTGTCTTGTCACTGTCCCTCTGCTCACGCCCTCGCCCCTAGAAAATCGTGCAATCCACCAAACAGTGCCTGAC
CATCGCGTCAAGTTGACTCCCGAGGGCTGTCTACAGGCTGCCGATGCTGGCCGCCGCCTGCGAAGCCTCCTGCGC
CCCGACGATAGTCTCCAAATCTTCACTTCGCCATACCGTCGCACGCGTGAAACGACGGACGGCATCATCGAAACC
TTGACATCTGACGACCCCGAACCCTCGCCCTTTCGCCGTGCCGACATCAAGGTCTATGAGGAGCCGCGTCTGCGA
GAACAAGACTTTGGCAACTTCCAGCCTTGTAGCGCAGAGATGGAGCGCATGTGGCAGGAGAGGGCAGACTACGGC
CACTTCTTCTATCGCATTCCCAATGGCGAGAGCGCTGCCGATGCCTACGACCGCATCAGCGGCTTCAACGAGAGT
CTGTGGCGCCAGTTTGGCGACGATGACTTTCCCAGCGTCTGCATTCTCGGTACGTTTACCCTGCTGACCCCATGA
TGCTCTTCTTGGTCTCTGACATGTCCAAGTCACTCATGGTCTCATGTCGCGCGTCTTTCTCATGAAGTGGTATCA
CTTCACCGTCGAGTACTTTGAGGATTTGCGCAATGTCAACCACTGCGAGTTCCTCATTATGCGCCACGAGGACAA
TGGAAAGTACCTGCTCGAGAACAAGCTGCGGACTTGGTCTGAGCTGCGCCGCGAACGCGCCCAGGCCAGCACCAA
GGAGGAACGGGCAAAACTCGATGGCCCCAGGGCAGCTGCTGCCATGCGCCGCTGGGGAGGCTGTCCCAACGGGTG
CAACCACTCGAGTCACTACAAAAAGTACCACGACCTTGATTCCTTGCGCCAGCGTGACAGCGATCCCATGCCAAA
CGCCAGCGGCAATGCTAGCAGCAGTAGCAACGACGCCATGACCATTGCCAGCCGGAGACTTCGTCTTCATCGCCC
CACGACATCTGACGACGGCGATGACGAGCAGAGCGATCGGCCGCGCGTCCCGGTGGCCGTGGCTGTTCAAGTCTC
GTCGCACAATGTCCGCGAAGAAGAGCTGTCGTCGCCCGACGGCACGCCCTCCTTCATCACCGCCGAAGACCGGCT
GCGCAGCCGCAAGTCTCCCCACTTGCACGTGCACCTTGGCCGCGACTTTGGCGGCACCTATTCGGGCCACGCCTC
GGTTGCCGGCAGCGAAACCGACGGCGTCACCGACTGCGATAGTGACCGGGATCCCGCCACGGCCAGCGGCACTCG
TCCCCGTGGCCGTCGCTGCGTCTTTGCAAACCGCCTCGGCGACGAGGATACGGATGGCGAGCAGTCAGCAGATGG
AGAGCCGCCTAGTGCGCTGCACAAAGACTTGGAAAGGGCTGAGAAGGAAGACCGCAGCATTGCCGGAAGTGTCTA
TTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail