Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2218
Gene name
LocationContig_177:14695..20849
Strand+
Gene length (bp)6154
Transcript length (bp)6099
Coding sequence length (bp)6099
Protein length (aa) 2033

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16172 DOCK_N DOCK N-terminus 5.0E-119 169 598
PF14429 DOCK-C2 C2 domain in Dock180 and Zizimin proteins 7.8E-39 601 795
PF00018 SH3_1 SH3 domain 6.9E-06 13 48

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BUR4|DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus GN=Dock1 PE=1 SV=3 535 1758 8.0E-87
sp|Q14185|DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens GN=DOCK1 PE=1 SV=2 535 1758 2.0E-86
sp|Q92608|DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens GN=DOCK2 PE=1 SV=2 486 1758 2.0E-76
sp|Q8N1I0|DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens GN=DOCK4 PE=1 SV=3 563 1762 6.0E-75
sp|Q8C3J5|DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus GN=Dock2 PE=1 SV=3 492 1714 3.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BUR4|DOCK1_MOUSE Dedicator of cytokinesis protein 1 OS=Mus musculus GN=Dock1 PE=1 SV=3 535 1758 8.0E-87
sp|Q14185|DOCK1_HUMAN Dedicator of cytokinesis protein 1 OS=Homo sapiens GN=DOCK1 PE=1 SV=2 535 1758 2.0E-86
sp|Q92608|DOCK2_HUMAN Dedicator of cytokinesis protein 2 OS=Homo sapiens GN=DOCK2 PE=1 SV=2 486 1758 2.0E-76
sp|Q8N1I0|DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens GN=DOCK4 PE=1 SV=3 563 1762 6.0E-75
sp|Q8C3J5|DOCK2_MOUSE Dedicator of cytokinesis protein 2 OS=Mus musculus GN=Dock2 PE=1 SV=3 492 1714 3.0E-72
sp|P59764|DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus GN=Dock4 PE=1 SV=1 563 1762 3.0E-71
sp|B2RY04|DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus GN=Dock5 PE=1 SV=2 1166 1714 5.0E-43
sp|Q06409|YL422_YEAST DOCK-like protein YLR422W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR422W PE=1 SV=1 1183 1847 6.0E-43
sp|Q9H7D0|DOCK5_HUMAN Dedicator of cytokinesis protein 5 OS=Homo sapiens GN=DOCK5 PE=1 SV=3 1166 1809 3.0E-40
sp|Q8CIQ7|DOCK3_MOUSE Dedicator of cytokinesis protein 3 OS=Mus musculus GN=Dock3 PE=1 SV=1 1159 1762 2.0E-39
sp|Q8IZD9|DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens GN=DOCK3 PE=1 SV=1 1159 1762 3.0E-39
sp|B2RY04|DOCK5_MOUSE Dedicator of cytokinesis protein 5 OS=Mus musculus GN=Dock5 PE=1 SV=2 535 1038 6.0E-32
sp|Q9H7D0|DOCK5_HUMAN Dedicator of cytokinesis protein 5 OS=Homo sapiens GN=DOCK5 PE=1 SV=3 535 1038 1.0E-30
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2218
MPWQPLPRIAFAVATYPFAAESPTELPLEIGDELYIIEETPDGNWLRGYLVAPPSLLAGLTSVKGQTLEARVFSG
IFPRSCVEVRELLGESDIGHGASGNGYGEEAASDSAKSGITYDNSPTKEQCNDKAARFLDSRKPLSELCNGAPGT
LSIPVKRDPDAPRPAAPVPMLKVGDENPTSASEPLIDEIASCLREWHSKNLHQLLLSRKYAELDQLSQVVNRLNL
SRQQFLYNVLTGREYEHLRERTVWDLVNVNKECGGEVIVRDPAARGRVLTAEDSAVELTRLQSLMSLLDEPPQAA
AELSSLHHILLEVKGFAGSSNEETTLELFLVCKPNHDKASNLSECFSVKIPSGGAIGGLAQDSSTRTLFTDLSGH
DIGETPSADSSIYLVVKVLSSQQIVSLAPLSRSSIGADSATSKDQHRSNSTGGHRSSRRSLMWGRSTLSRGQAAP
RLDSVAEGQQDKYMATASENCDQHIPPSTAGSAADGTVTQVQMVQRIVGIGALRLNSLVKQEGQVEEVINIWSPT
KTRQTQHNSENEELDSLIRQVMDSPHGEFEKSRRGERLQVCLQTFNHGDADALIRCTPTLLAGVSQTNRMGFSGA
PSKPRSDIYLTINAAALSRQHLLSRYGGSATSITPGLQGSNLQVSVEVRGPGGQTLERCIYTSSNHEGVTRFKSA
VVERGESWHQTIRLSLQPDDVPTAHVVFLLSDLPNAPFAVAHMPLWDQQAFVRDERHDVLLYRIDENTWTAKAGP
TGKGGYLSLPWALRGKDQHSADVTGPLAVLAVDSFLCSTRFSQDRVILGIVKWKELSHEDLTSVLRQLMFVAEIE
VVKLLNKVLDGLFGVIAENAGNEELEDLVFTALVRVLDIVHDRRFNLGPLVEEYAEKQFHYPYATSSLISTFTRL
LENPAEPETARKLRATFKVVRHIIKFISQARVQMREKEAVIGIKSSSQSFTRQLRTIFEALNAMMRNAAPALVGS
QTLAVQHFHTWLPELRGLLSTEEIVHIAIDFMDSCTQVKGKLILYKLVLIINYSRLELFGQAEQAAALCANTVRW
IGPHWGERDQVDEQWRSQVRLCCSVVASQVQHLGAEIPDHVGKMVDSYLGLVACGHKGRERLSLLFPTCYPFPSR
ATRQRVEHDEALGELAAVLAAVSSSPAGMQLELAEGDLTVLVDKLLRVHLSILEGEAFPAGWLSVQIYHHRSTMG
TLQYLADMMVASFLPDPDEAESFNTELWKLLLTTLVKLVASRSLALETFAEQKRRAVWKIGGDVREQGAELLRRT
WEAIGWEASDQDQERYGLAKLGGYQVQYVPTLVGPIVELCLSVHEGLRRTAVQVLQTMIVSEWALSQDLAVVQTD
MVDCLDHVFKTRPLTESMLQKLFVAELLERFEPLAAERDEPLYPAMRQLVATVDEFVDLLVAVHSSDEADDVSNT
INRLRLMEFLRDMQKEDIFVRYVHQLARFQAAAGNQPEAGLALRLHADLYDWDPMKQTPALTDPPMPAQSMFERK
ELLYFDMIKHFEEGESWSNALTAYKELQAQYETNVFDFAKLARTQRAIASIYQAMTASDNLVPRYFKVVYKGLGF
SPTVRDKGYIYQGSLAERASAFTDRMQEQYPSAHIITTGDTDEVEGQFLLVSAMTPHRDLAHAVYQRARVPQSAR
DFLLSSHPQAFSFTTHRHTIGPVHEHYADKLVFSTADPFPTLLRRSEIVDMYQVRLDAHQTALERIVRKTHEMTA
LERRLADGNDQDAQLLLDAVSVSVNAASEHSVVCYRKLLPEHQPQDDDDQDDDDDDGDDDDQQPELEPRDVAIKM
ALVDHAIMIKRCLALFARSNNERLVKKHPHLVKSFESVFEAEIAMFAPPQPAASQETALSPSAAFRGSLPPTEHN
LARQSMISPVHGSGSDEAATSTQQQQQQQQQQQQQQQQQQQNNPVRQRGTRFSFLGSRRHEAEHSPDSQGSTTNH
RDSMGKAPAAHGARSQSQDGKPQGRRSSRDSSDVASTQSAQGDAGDDGAKWKRSSVRKRLSRLALGKKNAKAGVV
MGSLDEE*
Coding >OphauG2|2218
ATGCCCTGGCAGCCTCTTCCCAGAATCGCCTTCGCCGTCGCGACGTATCCATTTGCCGCCGAGAGTCCGACCGAA
CTCCCTCTCGAGATTGGCGACGAGCTGTATATCATTGAAGAAACACCGGATGGCAATTGGCTTCGCGGCTATCTA
GTCGCCCCTCCGAGCCTGCTGGCGGGCCTCACGTCGGTCAAGGGCCAAACGTTGGAGGCGCGAGTCTTTAGCGGC
ATTTTCCCCCGGAGCTGTGTCGAAGTGCGAGAGCTGCTAGGCGAGTCAGACATTGGACATGGAGCCAGCGGAAAT
GGATATGGCGAAGAGGCGGCCAGCGACTCTGCAAAGAGCGGCATCACCTATGACAACTCTCCAACCAAGGAACAA
TGCAATGACAAGGCAGCCCGTTTTTTAGATTCCAGGAAGCCTCTGAGCGAGCTGTGCAATGGAGCTCCTGGTACG
CTGTCCATTCCTGTCAAGCGCGATCCTGATGCGCCACGGCCTGCAGCTCCAGTCCCAATGCTCAAGGTCGGAGAC
GAGAATCCCACCTCGGCCTCTGAGCCGCTCATAGACGAAATTGCGTCTTGTCTGCGCGAATGGCATTCAAAGAAC
CTCCACCAACTCTTGCTGTCTAGAAAGTACGCTGAGCTGGACCAGCTGTCACAAGTCGTCAATAGGCTCAATCTC
AGCCGTCAGCAGTTTCTATACAATGTTCTCACTGGTCGCGAGTACGAGCACCTGCGAGAGCGGACAGTCTGGGAT
CTGGTCAATGTCAACAAGGAGTGTGGCGGCGAGGTAATTGTGCGTGATCCAGCCGCTCGTGGTCGAGTCCTGACG
GCGGAGGACTCGGCTGTTGAGTTGACCAGACTCCAATCTCTAATGAGCCTTTTGGACGAGCCACCTCAAGCTGCC
GCTGAGCTATCAAGCCTCCATCATATATTGCTCGAGGTTAAGGGTTTTGCAGGATCTTCCAATGAGGAGACTACC
TTGGAACTTTTTCTTGTCTGCAAGCCGAATCATGACAAAGCGTCCAACTTGTCCGAGTGCTTCAGTGTCAAAATC
CCATCTGGCGGGGCCATTGGAGGTTTGGCGCAAGATTCGTCCACCAGAACCCTCTTTACCGACTTGTCTGGCCAC
GATATTGGCGAAACTCCCTCTGCAGACTCTTCCATATATCTTGTTGTAAAGGTGCTGTCCTCGCAACAAATTGTC
TCCTTGGCGCCGCTTTCGCGCTCTAGCATTGGTGCGGATTCCGCCACTTCAAAAGACCAGCACAGGAGCAACTCG
ACGGGCGGTCACAGATCATCAAGGAGGAGCCTAATGTGGGGACGCTCGACACTATCACGGGGTCAGGCGGCACCG
CGGTTGGACTCGGTAGCAGAGGGCCAGCAAGACAAATATATGGCGACTGCATCGGAGAATTGTGATCAACATATT
CCCCCGAGTACTGCAGGCTCTGCAGCTGATGGGACTGTGACACAAGTACAGATGGTACAGCGAATAGTCGGGATT
GGTGCCCTGAGGCTGAATTCTCTCGTCAAGCAAGAGGGTCAAGTTGAAGAGGTCATCAACATCTGGTCGCCCACC
AAGACGAGACAAACTCAGCACAACAGTGAAAACGAGGAGCTGGATTCACTGATTCGCCAAGTCATGGATAGCCCA
CATGGGGAATTCGAAAAGTCGCGCAGAGGCGAGCGCTTGCAAGTCTGCCTGCAGACATTCAACCATGGGGACGCG
GATGCTTTGATTAGGTGCACGCCGACTTTACTGGCTGGAGTCTCGCAGACGAACAGGATGGGCTTTTCTGGCGCT
CCTTCGAAGCCTCGATCTGACATTTATTTGACTATTAACGCGGCCGCTCTATCTCGACAGCACCTCTTATCCAGA
TATGGCGGCAGCGCAACAAGCATCACTCCCGGTCTCCAAGGCAGCAATCTGCAGGTCAGCGTGGAGGTTCGGGGG
CCGGGGGGCCAAACGTTGGAGAGGTGCATCTACACATCATCTAACCATGAAGGCGTGACAAGGTTCAAGTCGGCG
GTTGTGGAAAGAGGCGAATCTTGGCATCAGACAATACGGCTCTCGCTGCAGCCAGACGACGTGCCGACGGCGCAC
GTGGTGTTTTTGTTATCGGACCTACCCAATGCCCCTTTTGCGGTGGCGCACATGCCCCTTTGGGATCAGCAGGCC
TTTGTGCGTGACGAGCGCCATGATGTTTTACTGTACAGGATAGATGAAAACACATGGACTGCTAAAGCTGGGCCT
ACGGGCAAAGGGGGCTACTTGTCGTTGCCATGGGCGCTTCGCGGCAAGGACCAGCACTCTGCCGATGTAACTGGG
CCTTTGGCAGTGCTTGCAGTGGATTCCTTTCTCTGCAGCACGAGGTTTTCTCAAGACAGGGTGATACTTGGGATC
GTCAAGTGGAAAGAGCTGTCGCATGAGGACTTGACGTCGGTGCTCCGACAGCTAATGTTTGTGGCGGAAATCGAA
GTGGTGAAGCTGCTCAACAAGGTGCTGGACGGGCTGTTTGGGGTGATTGCAGAAAATGCCGGCAATGAGGAGCTC
GAGGATCTCGTCTTCACAGCACTGGTCAGGGTGCTTGACATTGTGCACGACCGGAGATTCAACCTGGGCCCGCTG
GTGGAGGAGTATGCGGAGAAGCAGTTCCACTATCCCTACGCCACGTCGAGCTTGATCAGCACCTTTACGCGGCTA
CTGGAAAACCCAGCAGAGCCAGAGACGGCACGCAAGCTTCGGGCGACGTTCAAGGTGGTGCGGCACATTATCAAG
TTTATCTCGCAGGCACGGGTTCAGATGAGGGAGAAGGAGGCGGTGATTGGGATCAAGTCGTCGTCGCAGAGCTTT
ACGCGGCAGCTGCGGACGATTTTCGAGGCACTCAATGCCATGATGCGCAATGCAGCGCCGGCGCTGGTTGGCAGC
CAGACGCTGGCAGTGCAGCATTTCCACACGTGGCTGCCCGAGCTCAGGGGGCTGCTGAGTACGGAGGAGATTGTG
CACATTGCCATTGACTTTATGGACTCGTGCACGCAGGTCAAGGGCAAGCTGATACTGTACAAGCTGGTGCTCATT
ATCAACTACTCCAGGCTGGAGCTGTTTGGGCAGGCAGAGCAGGCGGCGGCGCTGTGTGCCAACACTGTGCGATGG
ATTGGGCCGCACTGGGGCGAGAGGGACCAGGTTGACGAGCAGTGGCGCAGCCAGGTGCGGCTGTGCTGCTCCGTG
GTGGCCAGCCAGGTCCAGCACCTGGGGGCCGAGATACCGGACCACGTGGGCAAGATGGTGGACTCGTATCTGGGG
CTTGTGGCGTGCGGGCACAAGGGACGCGAGCGGCTGTCGCTCCTGTTCCCCACGTGCTACCCCTTTCCCAGCAGG
GCGACGAGGCAACGGGTGGAGCACGACGAGGCGCTGGGCGAGCTGGCGGCGGTGCTGGCGGCGGTGTCGAGCTCG
CCGGCAGGCATGCAGCTGGAGCTGGCCGAGGGCGACTTGACGGTGCTGGTGGACAAGCTGCTGCGGGTGCACCTG
AGCATCCTCGAGGGCGAGGCCTTCCCGGCTGGGTGGCTGAGCGTGCAAATCTACCACCACCGGTCGACCATGGGC
ACGCTGCAGTATCTGGCGGACATGATGGTGGCGTCGTTTCTGCCCGACCCCGACGAGGCGGAGAGCTTCAACACG
GAGCTGTGGAAGCTGCTGCTGACGACGCTGGTCAAGCTGGTGGCGAGCCGGAGCCTGGCGCTCGAGACGTTTGCC
GAGCAGAAGCGGCGGGCCGTGTGGAAGATTGGCGGCGACGTGCGCGAGCAGGGCGCGGAGCTGCTGCGCAGGACG
TGGGAGGCGATTGGGTGGGAGGCCAGCGACCAGGACCAGGAGCGCTACGGGCTGGCCAAGCTGGGCGGCTACCAG
GTGCAGTACGTGCCGACGCTGGTCGGCCCCATTGTCGAGCTGTGCCTCAGCGTGCACGAGGGCCTGCGGCGCACG
GCGGTGCAGGTGCTGCAGACCATGATTGTCAGCGAGTGGGCCTTGAGCCAGGACCTGGCCGTGGTGCAGACGGAC
ATGGTTGACTGCCTGGACCACGTCTTCAAGACGCGCCCGCTGACGGAGAGCATGCTGCAGAAGCTGTTTGTCGCC
GAGCTGCTGGAGCGCTTTGAGCCCCTGGCGGCGGAGCGCGACGAGCCGCTGTATCCCGCCATGCGGCAGCTGGTG
GCCACGGTGGACGAGTTTGTCGACTTGCTCGTGGCCGTGCACTCGAGCGACGAGGCCGACGACGTGTCCAACACC
ATCAACCGCCTGCGCCTCATGGAGTTTCTGCGCGACATGCAAAAGGAGGACATCTTTGTCCGCTACGTCCACCAG
CTGGCGCGCTTCCAGGCCGCGGCCGGCAACCAGCCCGAGGCCGGCCTGGCTCTGCGCCTCCACGCCGACCTGTAC
GACTGGGACCCCATGAAGCAGACGCCCGCTCTGACGGACCCCCCCATGCCTGCCCAGTCCATGTTTGAGCGCAAG
GAGCTGCTCTACTTTGACATGATTAAGCACTTTGAAGAGGGAGAGTCGTGGAGCAATGCCCTGACGGCCTACAAG
GAGCTGCAGGCCCAGTACGAGACCAACGTCTTTGATTTCGCCAAGCTGGCCCGCACCCAGCGCGCCATTGCCTCC
ATTTACCAAGCCATGACGGCCAGCGACAATTTGGTCCCGCGCTACTTCAAGGTGGTCTACAAGGGCCTCGGCTTT
TCCCCCACGGTCCGCGACAAGGGCTACATCTACCAGGGCTCATTGGCCGAGCGCGCCTCGGCCTTTACCGACCGC
ATGCAAGAGCAGTATCCGTCTGCCCACATCATCACCACGGGCGACACGGACGAGGTTGAGGGCCAGTTTCTCCTC
GTCTCTGCCATGACGCCCCATCGCGACTTGGCCCATGCCGTCTACCAGCGCGCTCGAGTGCCCCAGTCGGCCCGA
GACTTCTTGCTTTCCTCCCACCCCCAAGCCTTTTCCTTTACCACGCACCGCCATACTATCGGTCCTGTCCACGAG
CACTATGCCGACAAGTTGGTCTTTTCCACTGCCGACCCCTTTCCCACGCTTTTGCGCCGAAGCGAGATTGTCGAC
ATGTACCAAGTGCGTCTGGATGCCCACCAGACCGCCCTCGAGCGCATTGTCCGCAAGACGCACGAGATGACGGCT
CTGGAACGCCGCTTGGCCGACGGAAACGACCAAGATGCCCAGCTGCTCTTGGACGCCGTATCCGTGTCTGTCAAT
GCCGCGTCGGAGCATAGTGTTGTGTGCTACCGTAAGCTGCTGCCCGAGCACCAGCCACAAGACGACGACGACCAA
GACGACGACGACGATGACGGCGACGACGACGACCAGCAGCCTGAGCTGGAGCCTAGAGATGTGGCCATCAAGATG
GCCCTAGTTGACCATGCCATCATGATTAAGCGCTGTCTTGCTCTGTTTGCTCGAAGCAACAATGAGAGACTCGTC
AAGAAGCACCCCCATCTTGTCAAGTCTTTCGAGAGCGTCTTTGAAGCCGAGATTGCAATGTTTGCTCCCCCGCAG
CCCGCAGCATCCCAAGAGACCGCCTTGAGCCCGTCAGCGGCGTTTAGAGGCTCGCTGCCCCCCACTGAGCATAAT
CTGGCGCGCCAAAGCATGATAAGCCCCGTCCATGGCTCGGGCAGCGACGAGGCAGCGACAAGTACACAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAGCAGCAGAACAACCCCGTTCGCCAACGTGGCACC
CGATTCAGCTTTCTAGGCAGCCGCAGACACGAAGCCGAACACTCGCCCGATTCCCAAGGCAGTACGACAAATCAT
CGAGACAGCATGGGCAAGGCGCCCGCTGCACACGGCGCCCGTTCGCAGTCACAGGATGGCAAGCCACAGGGCAGA
CGGAGTAGTAGGGACAGCTCCGACGTGGCGTCGACCCAGAGTGCGCAAGGGGACGCGGGCGACGACGGCGCCAAG
TGGAAGCGCTCCAGCGTGCGCAAGAGACTAAGTCGCCTCGCCTTGGGCAAGAAGAATGCCAAGGCGGGAGTCGTA
ATGGGCAGTTTGGACGAAGAGTGA
Transcript >OphauG2|2218
ATGCCCTGGCAGCCTCTTCCCAGAATCGCCTTCGCCGTCGCGACGTATCCATTTGCCGCCGAGAGTCCGACCGAA
CTCCCTCTCGAGATTGGCGACGAGCTGTATATCATTGAAGAAACACCGGATGGCAATTGGCTTCGCGGCTATCTA
GTCGCCCCTCCGAGCCTGCTGGCGGGCCTCACGTCGGTCAAGGGCCAAACGTTGGAGGCGCGAGTCTTTAGCGGC
ATTTTCCCCCGGAGCTGTGTCGAAGTGCGAGAGCTGCTAGGCGAGTCAGACATTGGACATGGAGCCAGCGGAAAT
GGATATGGCGAAGAGGCGGCCAGCGACTCTGCAAAGAGCGGCATCACCTATGACAACTCTCCAACCAAGGAACAA
TGCAATGACAAGGCAGCCCGTTTTTTAGATTCCAGGAAGCCTCTGAGCGAGCTGTGCAATGGAGCTCCTGGTACG
CTGTCCATTCCTGTCAAGCGCGATCCTGATGCGCCACGGCCTGCAGCTCCAGTCCCAATGCTCAAGGTCGGAGAC
GAGAATCCCACCTCGGCCTCTGAGCCGCTCATAGACGAAATTGCGTCTTGTCTGCGCGAATGGCATTCAAAGAAC
CTCCACCAACTCTTGCTGTCTAGAAAGTACGCTGAGCTGGACCAGCTGTCACAAGTCGTCAATAGGCTCAATCTC
AGCCGTCAGCAGTTTCTATACAATGTTCTCACTGGTCGCGAGTACGAGCACCTGCGAGAGCGGACAGTCTGGGAT
CTGGTCAATGTCAACAAGGAGTGTGGCGGCGAGGTAATTGTGCGTGATCCAGCCGCTCGTGGTCGAGTCCTGACG
GCGGAGGACTCGGCTGTTGAGTTGACCAGACTCCAATCTCTAATGAGCCTTTTGGACGAGCCACCTCAAGCTGCC
GCTGAGCTATCAAGCCTCCATCATATATTGCTCGAGGTTAAGGGTTTTGCAGGATCTTCCAATGAGGAGACTACC
TTGGAACTTTTTCTTGTCTGCAAGCCGAATCATGACAAAGCGTCCAACTTGTCCGAGTGCTTCAGTGTCAAAATC
CCATCTGGCGGGGCCATTGGAGGTTTGGCGCAAGATTCGTCCACCAGAACCCTCTTTACCGACTTGTCTGGCCAC
GATATTGGCGAAACTCCCTCTGCAGACTCTTCCATATATCTTGTTGTAAAGGTGCTGTCCTCGCAACAAATTGTC
TCCTTGGCGCCGCTTTCGCGCTCTAGCATTGGTGCGGATTCCGCCACTTCAAAAGACCAGCACAGGAGCAACTCG
ACGGGCGGTCACAGATCATCAAGGAGGAGCCTAATGTGGGGACGCTCGACACTATCACGGGGTCAGGCGGCACCG
CGGTTGGACTCGGTAGCAGAGGGCCAGCAAGACAAATATATGGCGACTGCATCGGAGAATTGTGATCAACATATT
CCCCCGAGTACTGCAGGCTCTGCAGCTGATGGGACTGTGACACAAGTACAGATGGTACAGCGAATAGTCGGGATT
GGTGCCCTGAGGCTGAATTCTCTCGTCAAGCAAGAGGGTCAAGTTGAAGAGGTCATCAACATCTGGTCGCCCACC
AAGACGAGACAAACTCAGCACAACAGTGAAAACGAGGAGCTGGATTCACTGATTCGCCAAGTCATGGATAGCCCA
CATGGGGAATTCGAAAAGTCGCGCAGAGGCGAGCGCTTGCAAGTCTGCCTGCAGACATTCAACCATGGGGACGCG
GATGCTTTGATTAGGTGCACGCCGACTTTACTGGCTGGAGTCTCGCAGACGAACAGGATGGGCTTTTCTGGCGCT
CCTTCGAAGCCTCGATCTGACATTTATTTGACTATTAACGCGGCCGCTCTATCTCGACAGCACCTCTTATCCAGA
TATGGCGGCAGCGCAACAAGCATCACTCCCGGTCTCCAAGGCAGCAATCTGCAGGTCAGCGTGGAGGTTCGGGGG
CCGGGGGGCCAAACGTTGGAGAGGTGCATCTACACATCATCTAACCATGAAGGCGTGACAAGGTTCAAGTCGGCG
GTTGTGGAAAGAGGCGAATCTTGGCATCAGACAATACGGCTCTCGCTGCAGCCAGACGACGTGCCGACGGCGCAC
GTGGTGTTTTTGTTATCGGACCTACCCAATGCCCCTTTTGCGGTGGCGCACATGCCCCTTTGGGATCAGCAGGCC
TTTGTGCGTGACGAGCGCCATGATGTTTTACTGTACAGGATAGATGAAAACACATGGACTGCTAAAGCTGGGCCT
ACGGGCAAAGGGGGCTACTTGTCGTTGCCATGGGCGCTTCGCGGCAAGGACCAGCACTCTGCCGATGTAACTGGG
CCTTTGGCAGTGCTTGCAGTGGATTCCTTTCTCTGCAGCACGAGGTTTTCTCAAGACAGGGTGATACTTGGGATC
GTCAAGTGGAAAGAGCTGTCGCATGAGGACTTGACGTCGGTGCTCCGACAGCTAATGTTTGTGGCGGAAATCGAA
GTGGTGAAGCTGCTCAACAAGGTGCTGGACGGGCTGTTTGGGGTGATTGCAGAAAATGCCGGCAATGAGGAGCTC
GAGGATCTCGTCTTCACAGCACTGGTCAGGGTGCTTGACATTGTGCACGACCGGAGATTCAACCTGGGCCCGCTG
GTGGAGGAGTATGCGGAGAAGCAGTTCCACTATCCCTACGCCACGTCGAGCTTGATCAGCACCTTTACGCGGCTA
CTGGAAAACCCAGCAGAGCCAGAGACGGCACGCAAGCTTCGGGCGACGTTCAAGGTGGTGCGGCACATTATCAAG
TTTATCTCGCAGGCACGGGTTCAGATGAGGGAGAAGGAGGCGGTGATTGGGATCAAGTCGTCGTCGCAGAGCTTT
ACGCGGCAGCTGCGGACGATTTTCGAGGCACTCAATGCCATGATGCGCAATGCAGCGCCGGCGCTGGTTGGCAGC
CAGACGCTGGCAGTGCAGCATTTCCACACGTGGCTGCCCGAGCTCAGGGGGCTGCTGAGTACGGAGGAGATTGTG
CACATTGCCATTGACTTTATGGACTCGTGCACGCAGGTCAAGGGCAAGCTGATACTGTACAAGCTGGTGCTCATT
ATCAACTACTCCAGGCTGGAGCTGTTTGGGCAGGCAGAGCAGGCGGCGGCGCTGTGTGCCAACACTGTGCGATGG
ATTGGGCCGCACTGGGGCGAGAGGGACCAGGTTGACGAGCAGTGGCGCAGCCAGGTGCGGCTGTGCTGCTCCGTG
GTGGCCAGCCAGGTCCAGCACCTGGGGGCCGAGATACCGGACCACGTGGGCAAGATGGTGGACTCGTATCTGGGG
CTTGTGGCGTGCGGGCACAAGGGACGCGAGCGGCTGTCGCTCCTGTTCCCCACGTGCTACCCCTTTCCCAGCAGG
GCGACGAGGCAACGGGTGGAGCACGACGAGGCGCTGGGCGAGCTGGCGGCGGTGCTGGCGGCGGTGTCGAGCTCG
CCGGCAGGCATGCAGCTGGAGCTGGCCGAGGGCGACTTGACGGTGCTGGTGGACAAGCTGCTGCGGGTGCACCTG
AGCATCCTCGAGGGCGAGGCCTTCCCGGCTGGGTGGCTGAGCGTGCAAATCTACCACCACCGGTCGACCATGGGC
ACGCTGCAGTATCTGGCGGACATGATGGTGGCGTCGTTTCTGCCCGACCCCGACGAGGCGGAGAGCTTCAACACG
GAGCTGTGGAAGCTGCTGCTGACGACGCTGGTCAAGCTGGTGGCGAGCCGGAGCCTGGCGCTCGAGACGTTTGCC
GAGCAGAAGCGGCGGGCCGTGTGGAAGATTGGCGGCGACGTGCGCGAGCAGGGCGCGGAGCTGCTGCGCAGGACG
TGGGAGGCGATTGGGTGGGAGGCCAGCGACCAGGACCAGGAGCGCTACGGGCTGGCCAAGCTGGGCGGCTACCAG
GTGCAGTACGTGCCGACGCTGGTCGGCCCCATTGTCGAGCTGTGCCTCAGCGTGCACGAGGGCCTGCGGCGCACG
GCGGTGCAGGTGCTGCAGACCATGATTGTCAGCGAGTGGGCCTTGAGCCAGGACCTGGCCGTGGTGCAGACGGAC
ATGGTTGACTGCCTGGACCACGTCTTCAAGACGCGCCCGCTGACGGAGAGCATGCTGCAGAAGCTGTTTGTCGCC
GAGCTGCTGGAGCGCTTTGAGCCCCTGGCGGCGGAGCGCGACGAGCCGCTGTATCCCGCCATGCGGCAGCTGGTG
GCCACGGTGGACGAGTTTGTCGACTTGCTCGTGGCCGTGCACTCGAGCGACGAGGCCGACGACGTGTCCAACACC
ATCAACCGCCTGCGCCTCATGGAGTTTCTGCGCGACATGCAAAAGGAGGACATCTTTGTCCGCTACGTCCACCAG
CTGGCGCGCTTCCAGGCCGCGGCCGGCAACCAGCCCGAGGCCGGCCTGGCTCTGCGCCTCCACGCCGACCTGTAC
GACTGGGACCCCATGAAGCAGACGCCCGCTCTGACGGACCCCCCCATGCCTGCCCAGTCCATGTTTGAGCGCAAG
GAGCTGCTCTACTTTGACATGATTAAGCACTTTGAAGAGGGAGAGTCGTGGAGCAATGCCCTGACGGCCTACAAG
GAGCTGCAGGCCCAGTACGAGACCAACGTCTTTGATTTCGCCAAGCTGGCCCGCACCCAGCGCGCCATTGCCTCC
ATTTACCAAGCCATGACGGCCAGCGACAATTTGGTCCCGCGCTACTTCAAGGTGGTCTACAAGGGCCTCGGCTTT
TCCCCCACGGTCCGCGACAAGGGCTACATCTACCAGGGCTCATTGGCCGAGCGCGCCTCGGCCTTTACCGACCGC
ATGCAAGAGCAGTATCCGTCTGCCCACATCATCACCACGGGCGACACGGACGAGGTTGAGGGCCAGTTTCTCCTC
GTCTCTGCCATGACGCCCCATCGCGACTTGGCCCATGCCGTCTACCAGCGCGCTCGAGTGCCCCAGTCGGCCCGA
GACTTCTTGCTTTCCTCCCACCCCCAAGCCTTTTCCTTTACCACGCACCGCCATACTATCGGTCCTGTCCACGAG
CACTATGCCGACAAGTTGGTCTTTTCCACTGCCGACCCCTTTCCCACGCTTTTGCGCCGAAGCGAGATTGTCGAC
ATGTACCAAGTGCGTCTGGATGCCCACCAGACCGCCCTCGAGCGCATTGTCCGCAAGACGCACGAGATGACGGCT
CTGGAACGCCGCTTGGCCGACGGAAACGACCAAGATGCCCAGCTGCTCTTGGACGCCGTATCCGTGTCTGTCAAT
GCCGCGTCGGAGCATAGTGTTGTGTGCTACCGTAAGCTGCTGCCCGAGCACCAGCCACAAGACGACGACGACCAA
GACGACGACGACGATGACGGCGACGACGACGACCAGCAGCCTGAGCTGGAGCCTAGAGATGTGGCCATCAAGATG
GCCCTAGTTGACCATGCCATCATGATTAAGCGCTGTCTTGCTCTGTTTGCTCGAAGCAACAATGAGAGACTCGTC
AAGAAGCACCCCCATCTTGTCAAGTCTTTCGAGAGCGTCTTTGAAGCCGAGATTGCAATGTTTGCTCCCCCGCAG
CCCGCAGCATCCCAAGAGACCGCCTTGAGCCCGTCAGCGGCGTTTAGAGGCTCGCTGCCCCCCACTGAGCATAAT
CTGGCGCGCCAAAGCATGATAAGCCCCGTCCATGGCTCGGGCAGCGACGAGGCAGCGACAAGTACACAGCAGCAG
CAGCAGCAGCAGCAGCAGCAGCAACAACAACAACAACAACAGCAGCAGAACAACCCCGTTCGCCAACGTGGCACC
CGATTCAGCTTTCTAGGCAGCCGCAGACACGAAGCCGAACACTCGCCCGATTCCCAAGGCAGTACGACAAATCAT
CGAGACAGCATGGGCAAGGCGCCCGCTGCACACGGCGCCCGTTCGCAGTCACAGGATGGCAAGCCACAGGGCAGA
CGGAGTAGTAGGGACAGCTCCGACGTGGCGTCGACCCAGAGTGCGCAAGGGGACGCGGGCGACGACGGCGCCAAG
TGGAAGCGCTCCAGCGTGCGCAAGAGACTAAGTCGCCTCGCCTTGGGCAAGAAGAATGCCAAGGCGGGAGTCGTA
ATGGGCAGTTTGGACGAAGAGTGA
Gene >OphauG2|2218
ATGCCCTGGCAGCCTCTTCCCAGAATCGCCTTCGCCGTCGCGACGTATCCATTTGCCGCCGAGAGTCCGACCGAA
CTCCCTCTCGAGATTGGCGACGAGCTGTATATCATTGAAGAAACACCGGATGGCAATTGGCTTCGCGGCTATCTA
GTCGCCCCTCCGAGCCTGCTGGCGGGCCTCACGTCGGTCAAGGGCCAAACGTTGGAGGCGCGAGTCTTTAGCGGC
ATTTTCCCCCGGAGCTGTGTCGAAGTGCGAGAGCTGCTAGGCGAGTCAGACATTGGACATGGAGCCAGCGGAAAT
GGATATGGCGAAGAGGCGGCCAGCGACTCTGCAAAGAGCGGCATCACCTATGACAACTCTCCAACCAAGGAACAA
TGCAATGACAAGGCAGCCCGTTTTTTAGATTCCAGGAAGCCTCTGAGCGAGCTGTGCAATGGAGCTCCTGGTACG
CTGTCCATTCCTGTCAAGCGCGATCCTGATGCGCCACGGCCTGCAGCTCCAGTCCCAATGCTCAAGGTCGGAGAC
GAGAATCCCACCTCGGCCTCTGAGCCGCTCATAGACGAAATTGCGTCTTGTCTGCGCGAATGGCATTCAAAGAAC
CTCCACCAACTCTTGCTGTCTAGAAAGTACGCTGAGCTGGACCAGCTGTCACAAGTCGTCAATAGGCTCAATCTC
AGCCGTCAGCAGTTTCTATACAATGTTCTCACTGGTCGCGAGTACGAGCACCTGCGAGAGCGGACAGTCTGGGAT
CTGGTCAATGTCAACAAGGAGTGTGGCGGCGAGGTAATTGTGCGTGATCCAGCCGCTCGTGGTCGAGTCCTGACG
GCGGAGGACTCGGCTGTTGAGTTGACCAGACTCCAATCTCTAATGAGCCTTTTGGACGAGCCACCTCAAGCTGCC
GCTGAGCTATCAAGCCTCCATCATATATTGCTCGAGGTTAAGGGTTTTGCAGGATCTTCCAATGAGGAGACTACC
TTGGAACTTTTTCTTGTCTGCAAGCCGAATCATGACAAAGCGTCCAACTTGTCCGAGTGCTTCAGTGTCAAAATC
CCATCTGGCGGGGCCATTGGAGGTTTGGCGCAAGATTCGTCCACCAGAACCCTCTTTACCGACTTGTCTGGCCAC
GATATTGGCGAAACTCCCTCTGCAGACTCTTCCATATATCTTGTTGTAAAGGTGCTGTCCTCGCAACAAATTGTC
TCCTTGGCGCCGCTTTCGCGCTCTAGCATTGGTGCGGATTCCGCCACTTCAAAAGACCAGCACAGGAGCAACTCG
ACGGGCGGTCACAGATCATCAAGGAGGAGCCTAATGTGGGGACGCTCGACACTATCACGGGGTCAGGCGGCACCG
CGGTTGGACTCGGTAGCAGAGGGCCAGCAAGACAAATATATGGCGACTGCATCGGAGAATTGTGATCAACATATT
CCCCCGAGTACTGCAGGCTCTGCAGCTGATGGGACTGTGACACAAGTACAGATGGTACAGCGAATAGTCGGGATT
GGTGCCCTGAGGCTGAATTCTCTCGTCAAGCAAGAGGGTCAAGTTGAAGAGGTCATCAACATCTGGTCGCCCACC
AAGACGAGACAAACTCAGCACAACAGTGAAAACGAGGAGCTGGATTCACTGATTCGCCAAGTCATGGATAGCCCA
CATGGGGAATTCGAAAAGTCGCGCAGAGGCGAGCGCTTGCAAGTCTGCCTGCAGACATTCAACCATGGGGACGCG
GATGCTTTGATTAGGTGCACGCCGACTTTACTGGCTGGAGTCTCGCAGACGAACAGGATGGGCTTTTCTGGCGCT
CCTTCGAAGCCTCGATCTGACATTTATTTGACTATTAACGCGGCCGCTCTATCTCGACAGCACCTCTTATCCAGA
TATGGCGGCAGCGCAACAAGCATCACTCCCGGTCTCCAAGGCAGCAATCTGCAGGTCAGCGTGGAGGTTCGGGGG
CCGGGGGGCCAAACGTTGGAGAGGTGCATCTACACATCATCTAACCATGAAGGCGTGACAAGGTTCAAGTCGGCG
GTTGTGGAAAGAGGCGAATCTTGGCATCAGACAATACGGCTCTCGCTGCAGCCAGACGACGTGCCGACGGCGCAC
GTGGTGTTTTTGTTATCGGACCTACCCAATGCCCCTTTTGCGGTGGCGCACATGCCCCTTTGGGATCAGCAGGCC
TTTGTGCGTGACGAGCGCCATGATGTTTTACTGTACAGGATAGATGAAAACACATGGACTGCTAAAGCTGGGCCT
ACGGGCAAAGGGGGCTACTTGTCGTTGCCATGGGCGCTTCGCGGCAAGGACCAGCACTCTGCCGATGTAACTGGG
CCTTTGGCAGTGCTTGCAGTGGATTCCTTTCTCTGCAGCACGAGGTTTTCTCAAGACAGGGTGATACTTGGGATC
GTCAAGTGGAAAGAGCTGTCGCATGAGGACTTGACGTCGGTGCTCCGACAGCTAATGTTTGTGGCGGAAATCGAA
GTGGTGAAGCTGCTCAACAAGGTGCTGGACGGGCTGTTTGGGGTGATTGCAGAAAATGCCGGCAATGAGGAGCTC
GAGGATCTCGTCTTCACAGCACTGGTCAGGGTGCTTGACATTGTGCACGACCGGAGATTCAACCTGGGCCCGCTG
GTGGAGGAGTATGCGGAGAAGCAGTTCCACTATCCCTACGCCACGTCGAGCTTGATCAGCACCTTTACGCGGCTA
CTGGAAAACCCAGCAGAGCCAGAGACGGCACGCAAGCTTCGGGCGACGTTCAAGGTGGTGCGGCACATTATCAAG
TTTATCTCGCAGGCACGGGTTCAGATGAGGGAGAAGGAGGCGGTGATTGGGATCAAGTCGTCGTCGCAGAGCTTT
ACGCGGCAGCTGCGGACGATTTTCGAGGCACTCAATGCCATGATGCGCAATGCAGCGCCGGCGCTGGTTGGCAGC
CAGACGCTGGCAGTGCAGCATTTCCACACGTGGCTGCCCGAGCTCAGGGGGCTGCTGAGTACGGAGGAGATTGTG
CACATTGCCATTGACTTTATGGACTCGTGCACGCAGGTCAAGGGCAAGCTGATACTGTACAAGCTGGTGCTCATT
ATCAACTACTCCAGGCTGGAGCTGTTTGGGCAGGCAGAGCAGGCGGCGGCGCTGTGTGCCAACACTGTGCGATGG
ATTGGGCCGCACTGGGGCGAGAGGGACCAGGTTGACGAGCAGTGGCGCAGCCAGGTGCGGCTGTGCTGCTCCGTG
GTGGCCAGCCAGGTCCAGCACCTGGGGGCCGAGATACCGGACCACGTGGGCAAGATGGTGGACTCGTATCTGGGG
CTTGTGGCGTGCGGGCACAAGGGACGCGAGCGGCTGTCGCTCCTGTTCCCCACGTGCTACCCCTTTCCCAGCAGG
GCGACGAGGCAACGGGTGGAGCACGACGAGGCGCTGGGCGAGCTGGCGGCGGTGCTGGCGGCGGTGTCGAGCTCG
CCGGCAGGCATGCAGCTGGAGCTGGCCGAGGGCGACTTGACGGTGCTGGTGGACAAGCTGCTGCGGGTGCACCTG
AGCATCCTCGAGGGCGAGGCCTTCCCGGCTGGGTGGCTGAGCGTGCAAATCTACCACCACCGGTCGACCATGGGC
ACGCTGCAGTATCTGGCGGACATGATGGTGGCGTCGTTTCTGCCCGACCCCGACGAGGCGGAGAGCTTCAACACG
GAGCTGTGGAAGCTGCTGCTGACGACGCTGGTCAAGCTGGTGGCGAGCCGGAGCCTGGCGCTCGAGACGTTTGCC
GAGCAGAAGCGGCGGGCCGTGTGGAAGATTGGCGGCGACGTGCGCGAGCAGGGCGCGGAGCTGCTGCGCAGGACG
TGGGAGGCGATTGGGTGGGAGGCCAGCGACCAGGACCAGGAGCGCTACGGGCTGGCCAAGCTGGGCGGCTACCAG
GTGCAGTACGTGCCGACGCTGGTCGGCCCCATTGTCGAGCTGTGCCTCAGCGTGCACGAGGGCCTGCGGCGCACG
GCGGTGCAGGTGCTGCAGACCATGATTGTCAGCGAGTGGGCCTTGAGCCAGGACCTGGCCGTGGTGCAGACGGAC
ATGGTTGACTGCCTGGACCACGTCTTCAAGACGCGCCCGCTGACGGAGAGCATGCTGCAGAAGCTGTTTGTCGCC
GAGCTGCTGGAGCGCTTTGAGCCCCTGGCGGCGGAGCGCGACGAGCCGCTGTATCCCGCCATGCGGCAGCTGGTG
GCCACGGTGGACGAGTTTGTCGACTTGCTCGTGGCCGTGCACTCGAGCGACGAGGCCGACGACGTGTCCAACACC
ATCAACCGCCTGCGCCTCATGGAGTTTCTGCGCGACATGCAAAAGGAGGACATCTTTGTCCGCTACGTCCACCAG
CTGGCGCGCTTCCAGGCCGCGGCCGGCAACCAGCCCGAGGCCGGCCTGGCTCTGCGCCTCCACGCCGACCTGTAC
GACTGGGACCCCATGAAGCAGACGCCCGCTCTGACGGACCCCCCCATGCCTGCCCAGTCCATGTTTGAGCGCAAG
GAGCTGCTCTACTTTGACATGATTAAGCACTTTGAAGAGGGAGAGTCGTGGAGCAATGCCCTGACGGCCTACAAG
GAGCTGCAGGCCCAGTACGAGACCAACGTCTTTGATTTCGCCAAGCTGGCCCGCACCCAGCGCGCCATTGCCTCC
ATTTACCAAGCCATGACGGCCAGCGACAATTTGGTCCCGCGCTACTTCAAGGTGGTCTACAAGGGCCTCGGCTTT
TCCCCCACGGTCCGCGACAAGGGCTACATCTACCAGGGCTCATTGGCCGAGCGCGCCTCGGCCTTTACCGACCGC
ATGCAAGAGCAGTATCCGTCTGCCCACATCATCACCACGGGCGACACGGACGAGGTTGAGGGCCAGTTTCTCCTC
GTCTCTGCCATGACGCCCCATCGCGACTTGGCCCATGCCGTCTACCAGCGCGCTCGAGTGCCCCAGTCGGCCCGA
GACTTCTTGCTTTCCTCCCACCCCCAAGCCTTTTCCTTTACCACGCACCGCCATACTATCGGTCCTGTCCACGAG
CACTATGCCGACAAGTTGGTCTTTTCCACTGCCGACCCCTTTCCCACGCTTTTGCGCCGAAGCGAGATTGTCGAC
ATGTACCAAGTGCGTCTGGATGCCCACCAGACCGCCCTCGAGCGCATTGTCCGCAAGACGCACGAGATGACGGCT
CTGGAACGCCGCTTGGCCGACGGAAACGACCAAGATGCCCAGCTGCTCTTGGACGCCGTATCCGTGTCTGTCAAT
GCCGCGTCGGAGCATAGTGTTGTGTGCTACCGTAAGCTGCTGCCCGAGCACCAGCCACAAGACGACGACGACCAA
GACGACGACGACGATGACGGCGACGACGACGACCAGCAGCCTGAGCTGGAGCCTAGAGATGTGGCCATCAAGATG
GCCCTAGTTGACCATGCCATCATGATTAAGCGCTGTCTTGCTCTGTTTGCTCGAAGCAACAATGAGAGACTCGTC
AAGAAGCACCCCCATCTTGTCAAGTGTATGTTGCTGTTTTCCACGCTGCCCTTGATGCCCACAACTAATCATGCA
CACAGCTTTCGAGAGCGTCTTTGAAGCCGAGATTGCAATGTTTGCTCCCCCGCAGCCCGCAGCATCCCAAGAGAC
CGCCTTGAGCCCGTCAGCGGCGTTTAGAGGCTCGCTGCCCCCCACTGAGCATAATCTGGCGCGCCAAAGCATGAT
AAGCCCCGTCCATGGCTCGGGCAGCGACGAGGCAGCGACAAGTACACAGCAGCAGCAGCAGCAGCAGCAGCAGCA
GCAACAACAACAACAACAACAGCAGCAGAACAACCCCGTTCGCCAACGTGGCACCCGATTCAGCTTTCTAGGCAG
CCGCAGACACGAAGCCGAACACTCGCCCGATTCCCAAGGCAGTACGACAAATCATCGAGACAGCATGGGCAAGGC
GCCCGCTGCACACGGCGCCCGTTCGCAGTCACAGGATGGCAAGCCACAGGGCAGACGGAGTAGTAGGGACAGCTC
CGACGTGGCGTCGACCCAGAGTGCGCAAGGGGACGCGGGCGACGACGGCGCCAAGTGGAAGCGCTCCAGCGTGCG
CAAGAGACTAAGTCGCCTCGCCTTGGGCAAGAAGAATGCCAAGGCGGGAGTCGTAATGGGCAGTTTGGACGAAGA
GTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail