Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2212
Gene name
LocationContig_177:3034..4111
Strand-
Gene length (bp)1077
Transcript length (bp)1011
Coding sequence length (bp)1011
Protein length (aa) 337

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B3I5|A3024_ARTBC Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 188 242 2.0E-08
sp|P0DN32|CUPR1_ARTBC Probable GPI-anchored cupredoxin ARB_05732-1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05732-1 PE=1 SV=1 188 232 1.0E-06
sp|D4B3I5|A3024_ARTBC Extracellular serine-rich protein ARB_03024 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03024 PE=1 SV=1 38 75 4.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2212
MHLSSQIVVATLLGVAQGVDVHVVAVGKNPMTNETAQKYFPDKITAKPGDMVQFQFWAGNHTVTQSSFDQPCMPL
GMGASAEVPTGGQTSKVGSSPAGGRGSQRGAGASATSALPATASGAESEAGMAGSGSNKASLQKLEARAANSGAA
NSTSGSTGGRGTMAGMAGIYSSFMPVSASMSMGQIPVFTVMINDTKPLWIYCGQARHCQNGMVMVINENTQANPA
RSLEAFKTAAEKAPSSGEGSTPGGSSGSPGSGRGGETGGETGGETGRGGNTGGEAGRGGNEAGRAGATGGTPSEG
ATRPGQTSAVPMTGSSSTLTVPATMMLALSAAFMLL*
Coding >OphauG2|2212
ATGCACTTGTCATCACAAATTGTGGTTGCCACGCTGCTGGGCGTCGCTCAGGGTGTCGACGTCCACGTCGTTGCA
GTCGGCAAGAACCCCATGACGAATGAGACGGCGCAGAAATACTTCCCTGACAAGATCACGGCCAAGCCTGGCGAC
ATGGTCCAATTCCAGTTCTGGGCTGGCAACCATACCGTGACACAGTCCAGCTTCGACCAGCCCTGCATGCCGCTC
GGAATGGGTGCATCTGCAGAAGTGCCAACGGGCGGCCAAACCTCCAAGGTGGGCTCATCGCCCGCAGGCGGGAGG
GGATCGCAACGCGGAGCAGGGGCCTCTGCTACCAGTGCTCTGCCAGCCACGGCCAGTGGCGCGGAATCAGAAGCG
GGCATGGCTGGATCAGGCTCCAACAAGGCATCCCTCCAAAAGCTCGAGGCCAGAGCCGCAAACTCGGGAGCCGCA
AACTCGACGTCTGGCTCGACTGGAGGCAGAGGAACCATGGCTGGTATGGCTGGTATTTACTCGTCCTTTATGCCT
GTGTCGGCCAGCATGTCCATGGGCCAGATCCCCGTCTTCACAGTCATGATCAACGACACCAAGCCCCTCTGGATC
TACTGCGGCCAGGCGCGGCACTGCCAGAACGGCATGGTCATGGTCATCAATGAGAACACGCAGGCCAACCCGGCG
CGCTCTCTTGAAGCCTTCAAGACTGCGGCTGAGAAGGCTCCTTCGTCGGGCGAGGGCTCGACCCCTGGCGGCAGC
AGCGGCTCTCCTGGATCTGGCCGTGGCGGCGAGACTGGAGGCGAGACTGGAGGCGAGACTGGCAGAGGCGGAAAC
ACGGGTGGTGAAGCTGGCAGAGGCGGAAACGAGGCTGGCAGGGCCGGCGCAACTGGTGGCACTCCTAGCGAGGGA
GCCACCAGGCCGGGACAGACATCGGCTGTGCCCATGACAGGTTCCAGTTCGACATTGACGGTACCAGCAACCATG
ATGCTTGCTCTGAGCGCTGCATTCATGTTGCTGTAA
Transcript >OphauG2|2212
ATGCACTTGTCATCACAAATTGTGGTTGCCACGCTGCTGGGCGTCGCTCAGGGTGTCGACGTCCACGTCGTTGCA
GTCGGCAAGAACCCCATGACGAATGAGACGGCGCAGAAATACTTCCCTGACAAGATCACGGCCAAGCCTGGCGAC
ATGGTCCAATTCCAGTTCTGGGCTGGCAACCATACCGTGACACAGTCCAGCTTCGACCAGCCCTGCATGCCGCTC
GGAATGGGTGCATCTGCAGAAGTGCCAACGGGCGGCCAAACCTCCAAGGTGGGCTCATCGCCCGCAGGCGGGAGG
GGATCGCAACGCGGAGCAGGGGCCTCTGCTACCAGTGCTCTGCCAGCCACGGCCAGTGGCGCGGAATCAGAAGCG
GGCATGGCTGGATCAGGCTCCAACAAGGCATCCCTCCAAAAGCTCGAGGCCAGAGCCGCAAACTCGGGAGCCGCA
AACTCGACGTCTGGCTCGACTGGAGGCAGAGGAACCATGGCTGGTATGGCTGGTATTTACTCGTCCTTTATGCCT
GTGTCGGCCAGCATGTCCATGGGCCAGATCCCCGTCTTCACAGTCATGATCAACGACACCAAGCCCCTCTGGATC
TACTGCGGCCAGGCGCGGCACTGCCAGAACGGCATGGTCATGGTCATCAATGAGAACACGCAGGCCAACCCGGCG
CGCTCTCTTGAAGCCTTCAAGACTGCGGCTGAGAAGGCTCCTTCGTCGGGCGAGGGCTCGACCCCTGGCGGCAGC
AGCGGCTCTCCTGGATCTGGCCGTGGCGGCGAGACTGGAGGCGAGACTGGAGGCGAGACTGGCAGAGGCGGAAAC
ACGGGTGGTGAAGCTGGCAGAGGCGGAAACGAGGCTGGCAGGGCCGGCGCAACTGGTGGCACTCCTAGCGAGGGA
GCCACCAGGCCGGGACAGACATCGGCTGTGCCCATGACAGGTTCCAGTTCGACATTGACGGTACCAGCAACCATG
ATGCTTGCTCTGAGCGCTGCATTCATGTTGCTGTAA
Gene >OphauG2|2212
ATGCACTTGTCATCACAAATTGTGGTTGCCACGCTGCTGGGCGTCGCTCAGGGTAAGACAGGCTTTTTTGGTGTG
CAAGTCTTGAAGAGACTAGAGGCTGACAGGAAACGAATGCTAGGTGTCGACGTCCACGTCGTTGCAGTCGGCAAG
AACCCCATGACGAATGAGACGGCGCAGAAATACTTCCCTGACAAGATCACGGCCAAGCCTGGCGACATGGTCCAA
TTCCAGTTCTGGGCTGGCAACCATACCGTGACACAGTCCAGCTTCGACCAGCCCTGCATGCCGCTCGGAATGGGT
GCATCTGCAGAAGTGCCAACGGGCGGCCAAACCTCCAAGGTGGGCTCATCGCCCGCAGGCGGGAGGGGATCGCAA
CGCGGAGCAGGGGCCTCTGCTACCAGTGCTCTGCCAGCCACGGCCAGTGGCGCGGAATCAGAAGCGGGCATGGCT
GGATCAGGCTCCAACAAGGCATCCCTCCAAAAGCTCGAGGCCAGAGCCGCAAACTCGGGAGCCGCAAACTCGACG
TCTGGCTCGACTGGAGGCAGAGGAACCATGGCTGGTATGGCTGGTATTTACTCGTCCTTTATGCCTGTGTCGGCC
AGCATGTCCATGGGCCAGATCCCCGTCTTCACAGTCATGATCAACGACACCAAGCCCCTCTGGATCTACTGCGGC
CAGGCGCGGCACTGCCAGAACGGCATGGTCATGGTCATCAATGAGAACACGCAGGCCAACCCGGCGCGCTCTCTT
GAAGCCTTCAAGACTGCGGCTGAGAAGGCTCCTTCGTCGGGCGAGGGCTCGACCCCTGGCGGCAGCAGCGGCTCT
CCTGGATCTGGCCGTGGCGGCGAGACTGGAGGCGAGACTGGAGGCGAGACTGGCAGAGGCGGAAACACGGGTGGT
GAAGCTGGCAGAGGCGGAAACGAGGCTGGCAGGGCCGGCGCAACTGGTGGCACTCCTAGCGAGGGAGCCACCAGG
CCGGGACAGACATCGGCTGTGCCCATGACAGGTTCCAGTTCGACATTGACGGTACCAGCAACCATGATGCTTGCT
CTGAGCGCTGCATTCATGTTGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail