Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2205
Gene name
LocationContig_1762:250..896
Strand+
Gene length (bp)646
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 2.1E-16 53 145
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.3E-09 87 149
PF13508 Acetyltransf_7 Acetyltransferase (GNAT) domain 7.7E-09 68 145
PF08445 FR47 FR47-like protein 1.1E-08 88 148
PF13523 Acetyltransf_8 Acetyltransferase (GNAT) domain 1.1E-06 54 150
PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain 1.3E-05 69 145

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74311|NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa30 PE=3 SV=1 24 166 3.0E-43
sp|Q8CES0|NAA30_MOUSE N-alpha-acetyltransferase 30 OS=Mus musculus GN=Naa30 PE=1 SV=2 8 169 2.0E-42
sp|Q147X3|NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens GN=NAA30 PE=1 SV=1 12 169 2.0E-42
sp|Q0IHH1|NAA30_XENLA N-alpha-acetyltransferase 30 OS=Xenopus laevis GN=naa30 PE=2 SV=1 26 169 3.0E-42
sp|O80438|MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana GN=MAK3 PE=2 SV=1 25 191 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74311|NAA30_SCHPO N-alpha-acetyltransferase 30 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=naa30 PE=3 SV=1 24 166 3.0E-43
sp|Q8CES0|NAA30_MOUSE N-alpha-acetyltransferase 30 OS=Mus musculus GN=Naa30 PE=1 SV=2 8 169 2.0E-42
sp|Q147X3|NAA30_HUMAN N-alpha-acetyltransferase 30 OS=Homo sapiens GN=NAA30 PE=1 SV=1 12 169 2.0E-42
sp|Q0IHH1|NAA30_XENLA N-alpha-acetyltransferase 30 OS=Xenopus laevis GN=naa30 PE=2 SV=1 26 169 3.0E-42
sp|O80438|MAK3_ARATH N-alpha-acetyltransferase MAK3 OS=Arabidopsis thaliana GN=MAK3 PE=2 SV=1 25 191 1.0E-41
sp|Q03503|NAA30_YEAST N-alpha-acetyltransferase 30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK3 PE=1 SV=1 26 168 2.0E-41
sp|Q95RC0|NAA30_DROME N-alpha-acetyltransferase 30 OS=Drosophila melanogaster GN=CG11412 PE=2 SV=1 11 166 6.0E-40
sp|Q54MP9|NAA30_DICDI N-alpha-acetyltransferase 30 OS=Dictyostelium discoideum GN=DDB_G0285803 PE=3 SV=1 31 168 8.0E-35
sp|Q976C3|Y258_SULTO Uncharacterized N-acetyltransferase STK_02580 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_02580 PE=3 SV=1 37 168 3.0E-14
sp|Q4JBG0|Y459_SULAC Uncharacterized N-acetyltransferase Saci_0459 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=Saci_0459 PE=3 SV=1 10 168 5.0E-14
sp|Q980R9|Y209_SULSO Uncharacterized N-acetyltransferase SSO0209 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=SSO0209 PE=1 SV=2 37 168 6.0E-13
sp|P36416|ARD1_DICDI N-terminal acetyltransferase complex ARD1 subunit homolog OS=Dictyostelium discoideum GN=natA PE=2 SV=1 37 168 2.0E-07
sp|Q2KI14|NAA10_BOVIN N-alpha-acetyltransferase 10 OS=Bos taurus GN=NAA10 PE=2 SV=1 37 162 3.0E-07
sp|P41227|NAA10_HUMAN N-alpha-acetyltransferase 10 OS=Homo sapiens GN=NAA10 PE=1 SV=1 37 162 3.0E-07
sp|Q9QY36|NAA10_MOUSE N-alpha-acetyltransferase 10 OS=Mus musculus GN=Naa10 PE=1 SV=1 37 162 4.0E-07
sp|O61219|DAF31_CAEEL N-alpha-acetyltransferase daf-31 OS=Caenorhabditis elegans GN=daf-31 PE=2 SV=1 37 162 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0008080 N-acetyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016746 acyltransferase activity No
GO:0003824 catalytic activity No
GO:0016407 acetyltransferase activity No
GO:0016410 N-acyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5416
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2205 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5659
Ophiocordyceps camponoti-floridani Ophcf2|03231
Ophiocordyceps camponoti-rufipedis Ophun1|887
Ophiocordyceps kimflemingae Ophio5|89
Ophiocordyceps subramaniannii Hirsu2|5740

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2205
MALQDMCQPTELTYQQYNHGLEARYLSAIRSLISKDLSEPYSIYVYRYFLCQWAHLCFMALDPVDLSLIGVIVCK
LEAHSSHSPPTKRGYIAMLAVAAPFRGNGVATALVQRAIQAMAAQQADEVVLETEESNASAMRLYQRLGFLRSKK
LHRYYLSGNSAYRLILPLKALNQGVCPDYIYNDIALETLPRG*
Coding >OphauG2|2205
ATGGCCCTTCAAGACATGTGCCAGCCAACAGAACTCACTTATCAGCAATACAACCACGGACTAGAGGCACGCTAT
CTGTCAGCCATACGATCTCTTATTTCCAAAGATCTAAGCGAGCCGTATAGCATCTACGTCTACCGGTACTTTCTC
TGCCAGTGGGCTCACCTCTGCTTCATGGCACTCGACCCCGTTGATTTGTCCCTTATTGGTGTTATTGTCTGCAAG
CTTGAGGCTCACTCATCTCACTCCCCGCCTACCAAGCGCGGTTATATAGCCATGCTCGCTGTTGCGGCTCCTTTT
CGTGGTAACGGCGTCGCCACTGCCCTGGTTCAGAGAGCAATACAGGCAATGGCAGCTCAACAGGCAGACGAGGTT
GTACTAGAGACAGAAGAGTCCAACGCTTCGGCAATGAGACTTTACCAACGCCTAGGCTTTCTTCGATCCAAAAAG
CTCCATCGCTATTATCTCAGTGGCAATAGTGCCTATCGTCTCATCCTGCCTCTGAAGGCATTGAACCAAGGCGTA
TGTCCAGATTACATCTATAACGACATTGCCCTCGAGACATTGCCAAGAGGCTAG
Transcript >OphauG2|2205
ATGGCCCTTCAAGACATGTGCCAGCCAACAGAACTCACTTATCAGCAATACAACCACGGACTAGAGGCACGCTAT
CTGTCAGCCATACGATCTCTTATTTCCAAAGATCTAAGCGAGCCGTATAGCATCTACGTCTACCGGTACTTTCTC
TGCCAGTGGGCTCACCTCTGCTTCATGGCACTCGACCCCGTTGATTTGTCCCTTATTGGTGTTATTGTCTGCAAG
CTTGAGGCTCACTCATCTCACTCCCCGCCTACCAAGCGCGGTTATATAGCCATGCTCGCTGTTGCGGCTCCTTTT
CGTGGTAACGGCGTCGCCACTGCCCTGGTTCAGAGAGCAATACAGGCAATGGCAGCTCAACAGGCAGACGAGGTT
GTACTAGAGACAGAAGAGTCCAACGCTTCGGCAATGAGACTTTACCAACGCCTAGGCTTTCTTCGATCCAAAAAG
CTCCATCGCTATTATCTCAGTGGCAATAGTGCCTATCGTCTCATCCTGCCTCTGAAGGCATTGAACCAAGGCGTA
TGTCCAGATTACATCTATAACGACATTGCCCTCGAGACATTGCCAAGAGGCTAG
Gene >OphauG2|2205
ATGGCCCTTCAAGACATGTGCCAGCCAACAGAACTCACTTATCAGCAATACAACCACGGACTAGAGGCACGCTAT
CTGTCAGCCATACGATCTCTTATTTCCAAAGATCTAAGCGAGCCGTATAGCATCTACGTCTACCGGTACTTTCTC
TGCCAGTGGGCTCACCTCTGCTTCATGGTTGGCTTCTTGGCCCTCTCCTTGGCTTCTAGTCAATTTTTGATGCAC
TGACCATGTTGCCTTGTAGGCACTCGACCCCGTTGATTTGTCCCTTATTGGTGTTATTGTCTGCAAGCTTGAGGC
TCACTCATCTCACTCCCCGCCTACCAAGCGCGGTTATATAGCCATGCTCGCTGTTGCGGCTCCTTTTCGTGGTAA
CGGCGTCGCCACTGCCCTGGTTCAGAGAGCAATACAGGCAATGGCAGCTCAACAGGCAGACGAGGTTGTACTAGA
GACAGAAGAGTCCAACGCTTCGGCAATGAGACTTTACCAACGCCTAGGCTTTCTTCGATCCAAAAAGCTCCATCG
CTATTATCTCAGTGGCAATAGTGCCTATCGTCTCATCCTGCCTCTGAAGGCATTGAACCAAGGCGTATGTCCAGA
TTACATCTATAACGACATTGCCCTCGAGACATTGCCAAGAGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail