Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2197
Gene name
LocationContig_176:9782..11667
Strand-
Gene length (bp)1885
Transcript length (bp)1836
Coding sequence length (bp)1836
Protein length (aa) 612

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00307 CH Calponin homology (CH) domain 3.4E-13 24 127

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08873|SCP1_YEAST Transgelin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCP1 PE=1 SV=1 2 241 9.0E-32
sp|O14185|STG1_SCHPO Transgelin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stg1 PE=3 SV=1 20 142 7.0E-19
sp|P37397|CNN3_RAT Calponin-3 OS=Rattus norvegicus GN=Cnn3 PE=1 SV=1 6 139 6.0E-14
sp|Q15417|CNN3_HUMAN Calponin-3 OS=Homo sapiens GN=CNN3 PE=1 SV=1 18 139 1.0E-13
sp|Q32L92|CNN3_BOVIN Calponin-3 OS=Bos taurus GN=CNN3 PE=2 SV=1 18 139 1.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08873|SCP1_YEAST Transgelin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCP1 PE=1 SV=1 2 241 9.0E-32
sp|O14185|STG1_SCHPO Transgelin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=stg1 PE=3 SV=1 20 142 7.0E-19
sp|P37397|CNN3_RAT Calponin-3 OS=Rattus norvegicus GN=Cnn3 PE=1 SV=1 6 139 6.0E-14
sp|Q15417|CNN3_HUMAN Calponin-3 OS=Homo sapiens GN=CNN3 PE=1 SV=1 18 139 1.0E-13
sp|Q32L92|CNN3_BOVIN Calponin-3 OS=Bos taurus GN=CNN3 PE=2 SV=1 18 139 1.0E-13
sp|Q9DAW9|CNN3_MOUSE Calponin-3 OS=Mus musculus GN=Cnn3 PE=1 SV=1 18 139 2.0E-13
sp|Q24799|MYPH_ECHGR Myophilin OS=Echinococcus granulosus PE=2 SV=1 25 145 2.0E-13
sp|Q08290|CNN1_RAT Calponin-1 OS=Rattus norvegicus GN=Cnn1 PE=1 SV=1 6 127 4.0E-13
sp|Q9GK38|CNN1_MUSPF Calponin-1 OS=Mustela putorius furo GN=CNN1 PE=1 SV=1 6 127 4.0E-13
sp|Q08092|CNN1_PIG Calponin-1 OS=Sus scrofa GN=CNN1 PE=2 SV=1 6 127 7.0E-13
sp|P51911|CNN1_HUMAN Calponin-1 OS=Homo sapiens GN=CNN1 PE=1 SV=2 6 127 8.0E-13
sp|Q08091|CNN1_MOUSE Calponin-1 OS=Mus musculus GN=Cnn1 PE=1 SV=1 6 127 9.0E-13
sp|Q2HJ38|CNN1_BOVIN Calponin-1 OS=Bos taurus GN=CNN1 PE=2 SV=1 6 127 9.0E-13
sp|Q7YRL2|CNN1_SHEEP Calponin-1 OS=Ovis aries GN=CNN1 PE=2 SV=1 6 127 1.0E-12
sp|P26932|CNN1_CHICK Calponin-1 OS=Gallus gallus GN=CNN1 PE=1 SV=2 18 127 5.0E-12
sp|Q55E26|GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gxcB PE=2 SV=1 3 117 1.0E-11
sp|P14318|MP20_DROME Muscle-specific protein 20 OS=Drosophila melanogaster GN=Mp20 PE=2 SV=2 6 142 8.0E-11
sp|Q55E26|GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gxcB PE=2 SV=1 3 127 9.0E-11
sp|Q5R6R2|TAGL3_PONAB Transgelin-3 OS=Pongo abelii GN=TAGLN3 PE=2 SV=1 48 127 1.0E-10
sp|Q4R5J4|TAGL3_MACFA Transgelin-3 OS=Macaca fascicularis GN=TAGLN3 PE=2 SV=1 48 127 2.0E-10
sp|Q9UI15|TAGL3_HUMAN Transgelin-3 OS=Homo sapiens GN=TAGLN3 PE=1 SV=2 48 127 2.0E-10
sp|P37805|TAGL3_RAT Transgelin-3 OS=Rattus norvegicus GN=Tagln3 PE=1 SV=2 48 127 2.0E-10
sp|Q9R1Q8|TAGL3_MOUSE Transgelin-3 OS=Mus musculus GN=Tagln3 PE=1 SV=1 48 127 2.0E-10
sp|Q3ZBY2|TAGL3_BOVIN Transgelin-3 OS=Bos taurus GN=TAGLN3 PE=2 SV=1 48 127 2.0E-10
sp|Q9WVA4|TAGL2_MOUSE Transgelin-2 OS=Mus musculus GN=Tagln2 PE=1 SV=4 48 136 4.0E-10
sp|Q08093|CNN2_MOUSE Calponin-2 OS=Mus musculus GN=Cnn2 PE=1 SV=1 7 116 2.0E-09
sp|Q08094|CNN2_PIG Calponin-2 (Fragment) OS=Sus scrofa GN=CNN2 PE=2 SV=1 7 116 2.0E-09
sp|P37803|CNN1_MELGA Calponin-1 (Fragment) OS=Meleagris gallopavo GN=CNN1 PE=1 SV=1 7 127 4.0E-09
sp|Q5RFN6|CNN2_PONAB Calponin-2 OS=Pongo abelii GN=CNN2 PE=2 SV=3 7 127 6.0E-09
sp|Q99439|CNN2_HUMAN Calponin-2 OS=Homo sapiens GN=CNN2 PE=1 SV=4 7 127 6.0E-09
sp|Q3SYU6|CNN2_BOVIN Calponin-2 OS=Bos taurus GN=CNN2 PE=2 SV=3 18 116 2.0E-08
sp|Q55GV9|LIMCH_DICDI Calponin homology and LIM domain-containing protein OS=Dictyostelium discoideum GN=ChLim PE=1 SV=1 23 127 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2197
MASVTSLDKDLRRLRLDKYTPAAANEARAWVEDSLGQKLPSSDLIDGLRDGVALCRLVNLVLPPPGLKFKESAMP
FVQMENISQFLAACQAPPLNLHPHDTFLTVDLFEQKDPAQVLQCLGAFSRAAHAANPDRFPTTIGPKTRTGLSPQ
PTGPSTPSASRCLPAKPVLRHATGDSPRWSPTKTLAKSPSNTASPGNVTTWSKPEHEGATSPAWNIAQYGYMGGA
SQGNLGISFGGRRQITNAAPPVPSLAEKERRRRQEQERQQQEDDDEQERQRQRQQQDDDDERRWEQETQRLHDDE
RRKALAERQQWEQQERQWQLTEQQRRQEEQQAEARLEHDRRQLRSRSNTAKLRGQMLSQHRAHDDPDHPHTSRIR
QLEEELELARQREAEYQRQRHHRRPPAPAPVDTPAAKPRPRSRLASSKTPPAVKTPPAVKTPPASNTSPPEPPLS
RSGSWVSHDERDYLEGVDDEPHRPLPEPPLPAKPSASTASPPSTAATPRPLPDPATYSSPASSPASSRSLPRPRP
PPKSSLLEREMELERQRQREWEQAQQETARATPAPDAAATLGLGGRWDLGQWSGFTGGDGQNRGSHGIGAGRRQI
VGPRPLPEGGR*
Coding >OphauG2|2197
ATGGCATCCGTCACGTCGCTCGACAAGGATCTGCGCAGACTGCGCCTCGACAAATACACGCCCGCTGCTGCCAAC
GAGGCGCGCGCCTGGGTCGAGGATAGCCTGGGCCAGAAGCTGCCGTCTTCAGACCTCATTGACGGGCTGCGAGAC
GGCGTTGCGCTGTGCAGACTCGTCAACCTGGTCCTTCCGCCCCCCGGCCTCAAGTTCAAAGAGTCGGCCATGCCC
TTTGTCCAGATGGAAAACATTTCGCAATTCCTCGCCGCCTGCCAGGCCCCGCCCCTCAATCTCCACCCGCACGAC
ACCTTTTTGACCGTTGACTTGTTTGAGCAAAAAGACCCGGCTCAGGTGCTGCAGTGCCTGGGCGCATTCAGCAGA
GCGGCCCACGCCGCCAACCCTGACCGCTTTCCCACCACCATTGGCCCCAAGACACGCACAGGCCTGAGTCCACAG
CCCACTGGGCCCTCGACCCCCTCCGCCTCGCGATGCCTGCCCGCCAAGCCCGTCCTGCGCCACGCCACCGGCGAC
TCGCCCAGATGGAGCCCGACAAAGACACTCGCAAAGAGCCCTTCCAACACCGCCTCGCCCGGCAACGTCACCACC
TGGAGCAAGCCCGAGCACGAGGGCGCCACGTCGCCCGCCTGGAACATTGCCCAGTACGGCTACATGGGCGGCGCC
AGCCAGGGCAACCTGGGCATCTCGTTTGGCGGCCGCCGCCAAATCACCAATGCCGCGCCCCCCGTCCCCAGCTTG
GCCGAAAAGGAGCGTCGCCGTCGCCAGGAACAAGAGCGTCAGCAGCAAGAGGATGACGACGAGCAGGAGCGCCAG
CGCCAGCGTCAGCAACAAGACGACGACGACGAGCGCCGCTGGGAGCAAGAGACGCAGCGTCTGCACGACGACGAG
CGCCGCAAGGCCCTCGCCGAGCGCCAGCAGTGGGAGCAACAGGAACGCCAGTGGCAGCTGACGGAGCAGCAGCGC
CGCCAAGAGGAGCAGCAGGCCGAGGCGCGTCTGGAACATGACCGACGCCAGCTTCGAAGCCGCAGCAACACGGCC
AAGCTGCGCGGCCAGATGCTCAGCCAGCATCGTGCCCACGACGACCCCGACCACCCCCACACCTCTCGCATCCGC
CAGCTCGAGGAGGAGCTCGAGCTGGCCCGTCAGCGCGAGGCCGAGTACCAGCGCCAGCGCCACCACCGCCGCCCT
CCCGCCCCGGCCCCTGTCGACACGCCCGCTGCCAAACCGCGTCCTCGCAGCCGCCTGGCCTCGTCCAAGACGCCG
CCTGCTGTCAAGACGCCGCCTGCTGTCAAGACGCCGCCCGCCTCCAACACGAGCCCCCCCGAGCCCCCCCTATCC
CGCAGCGGCTCCTGGGTCTCCCACGACGAGCGCGACTACCTTGAAGGCGTCGACGACGAGCCTCACCGCCCTCTG
CCCGAGCCGCCACTCCCCGCCAAGCCCTCGGCCAGTACTGCCTCTCCTCCCTCCACCGCCGCCACTCCTCGCCCT
CTGCCCGACCCAGCAACCTACTCGTCTCCCGCCTCCTCACCAGCCTCGTCCCGCTCTCTCCCTCGCCCCCGTCCA
CCCCCAAAGTCGTCTCTCCTCGAGCGCGAAATGGAACTCGAGCGCCAGCGCCAGCGCGAGTGGGAACAGGCCCAG
CAGGAAACCGCCCGTGCTACTCCCGCTCCCGACGCCGCCGCCACTCTTGGCCTCGGCGGTCGCTGGGACCTGGGT
CAGTGGAGTGGCTTCACTGGCGGCGACGGCCAGAACCGTGGTTCCCATGGCATTGGCGCCGGCCGCCGACAAATC
GTCGGGCCCAGACCCTTGCCCGAAGGCGGTCGCTGA
Transcript >OphauG2|2197
ATGGCATCCGTCACGTCGCTCGACAAGGATCTGCGCAGACTGCGCCTCGACAAATACACGCCCGCTGCTGCCAAC
GAGGCGCGCGCCTGGGTCGAGGATAGCCTGGGCCAGAAGCTGCCGTCTTCAGACCTCATTGACGGGCTGCGAGAC
GGCGTTGCGCTGTGCAGACTCGTCAACCTGGTCCTTCCGCCCCCCGGCCTCAAGTTCAAAGAGTCGGCCATGCCC
TTTGTCCAGATGGAAAACATTTCGCAATTCCTCGCCGCCTGCCAGGCCCCGCCCCTCAATCTCCACCCGCACGAC
ACCTTTTTGACCGTTGACTTGTTTGAGCAAAAAGACCCGGCTCAGGTGCTGCAGTGCCTGGGCGCATTCAGCAGA
GCGGCCCACGCCGCCAACCCTGACCGCTTTCCCACCACCATTGGCCCCAAGACACGCACAGGCCTGAGTCCACAG
CCCACTGGGCCCTCGACCCCCTCCGCCTCGCGATGCCTGCCCGCCAAGCCCGTCCTGCGCCACGCCACCGGCGAC
TCGCCCAGATGGAGCCCGACAAAGACACTCGCAAAGAGCCCTTCCAACACCGCCTCGCCCGGCAACGTCACCACC
TGGAGCAAGCCCGAGCACGAGGGCGCCACGTCGCCCGCCTGGAACATTGCCCAGTACGGCTACATGGGCGGCGCC
AGCCAGGGCAACCTGGGCATCTCGTTTGGCGGCCGCCGCCAAATCACCAATGCCGCGCCCCCCGTCCCCAGCTTG
GCCGAAAAGGAGCGTCGCCGTCGCCAGGAACAAGAGCGTCAGCAGCAAGAGGATGACGACGAGCAGGAGCGCCAG
CGCCAGCGTCAGCAACAAGACGACGACGACGAGCGCCGCTGGGAGCAAGAGACGCAGCGTCTGCACGACGACGAG
CGCCGCAAGGCCCTCGCCGAGCGCCAGCAGTGGGAGCAACAGGAACGCCAGTGGCAGCTGACGGAGCAGCAGCGC
CGCCAAGAGGAGCAGCAGGCCGAGGCGCGTCTGGAACATGACCGACGCCAGCTTCGAAGCCGCAGCAACACGGCC
AAGCTGCGCGGCCAGATGCTCAGCCAGCATCGTGCCCACGACGACCCCGACCACCCCCACACCTCTCGCATCCGC
CAGCTCGAGGAGGAGCTCGAGCTGGCCCGTCAGCGCGAGGCCGAGTACCAGCGCCAGCGCCACCACCGCCGCCCT
CCCGCCCCGGCCCCTGTCGACACGCCCGCTGCCAAACCGCGTCCTCGCAGCCGCCTGGCCTCGTCCAAGACGCCG
CCTGCTGTCAAGACGCCGCCTGCTGTCAAGACGCCGCCCGCCTCCAACACGAGCCCCCCCGAGCCCCCCCTATCC
CGCAGCGGCTCCTGGGTCTCCCACGACGAGCGCGACTACCTTGAAGGCGTCGACGACGAGCCTCACCGCCCTCTG
CCCGAGCCGCCACTCCCCGCCAAGCCCTCGGCCAGTACTGCCTCTCCTCCCTCCACCGCCGCCACTCCTCGCCCT
CTGCCCGACCCAGCAACCTACTCGTCTCCCGCCTCCTCACCAGCCTCGTCCCGCTCTCTCCCTCGCCCCCGTCCA
CCCCCAAAGTCGTCTCTCCTCGAGCGCGAAATGGAACTCGAGCGCCAGCGCCAGCGCGAGTGGGAACAGGCCCAG
CAGGAAACCGCCCGTGCTACTCCCGCTCCCGACGCCGCCGCCACTCTTGGCCTCGGCGGTCGCTGGGACCTGGGT
CAGTGGAGTGGCTTCACTGGCGGCGACGGCCAGAACCGTGGTTCCCATGGCATTGGCGCCGGCCGCCGACAAATC
GTCGGGCCCAGACCCTTGCCCGAAGGCGGTCGCTGA
Gene >OphauG2|2197
ATGGCATCCGTCACGTCGCTCGACAAGGATCTGCGCAGACTGCGCCTCGACAAATACACGCCCGCTGCTGCCAAC
GAGGCGCGCGCCTGGGTCGAGGATAGCCTGGGCCAGAAGCTGCCGTCTTCAGACCTCATTGACGGGCTGCGAGAC
GGCGTTGCGCTGTGCAGGTGAGCAAGCAGCCAAGCCTCTTGACAAGACGCCCGGCTGACAATTCAGACTCGTCAA
CCTGGTCCTTCCGCCCCCCGGCCTCAAGTTCAAAGAGTCGGCCATGCCCTTTGTCCAGATGGAAAACATTTCGCA
ATTCCTCGCCGCCTGCCAGGCCCCGCCCCTCAATCTCCACCCGCACGACACCTTTTTGACCGTTGACTTGTTTGA
GCAAAAAGACCCGGCTCAGGTGCTGCAGTGCCTGGGCGCATTCAGCAGAGCGGCCCACGCCGCCAACCCTGACCG
CTTTCCCACCACCATTGGCCCCAAGACACGCACAGGCCTGAGTCCACAGCCCACTGGGCCCTCGACCCCCTCCGC
CTCGCGATGCCTGCCCGCCAAGCCCGTCCTGCGCCACGCCACCGGCGACTCGCCCAGATGGAGCCCGACAAAGAC
ACTCGCAAAGAGCCCTTCCAACACCGCCTCGCCCGGCAACGTCACCACCTGGAGCAAGCCCGAGCACGAGGGCGC
CACGTCGCCCGCCTGGAACATTGCCCAGTACGGCTACATGGGCGGCGCCAGCCAGGGCAACCTGGGCATCTCGTT
TGGCGGCCGCCGCCAAATCACCAATGCCGCGCCCCCCGTCCCCAGCTTGGCCGAAAAGGAGCGTCGCCGTCGCCA
GGAACAAGAGCGTCAGCAGCAAGAGGATGACGACGAGCAGGAGCGCCAGCGCCAGCGTCAGCAACAAGACGACGA
CGACGAGCGCCGCTGGGAGCAAGAGACGCAGCGTCTGCACGACGACGAGCGCCGCAAGGCCCTCGCCGAGCGCCA
GCAGTGGGAGCAACAGGAACGCCAGTGGCAGCTGACGGAGCAGCAGCGCCGCCAAGAGGAGCAGCAGGCCGAGGC
GCGTCTGGAACATGACCGACGCCAGCTTCGAAGCCGCAGCAACACGGCCAAGCTGCGCGGCCAGATGCTCAGCCA
GCATCGTGCCCACGACGACCCCGACCACCCCCACACCTCTCGCATCCGCCAGCTCGAGGAGGAGCTCGAGCTGGC
CCGTCAGCGCGAGGCCGAGTACCAGCGCCAGCGCCACCACCGCCGCCCTCCCGCCCCGGCCCCTGTCGACACGCC
CGCTGCCAAACCGCGTCCTCGCAGCCGCCTGGCCTCGTCCAAGACGCCGCCTGCTGTCAAGACGCCGCCTGCTGT
CAAGACGCCGCCCGCCTCCAACACGAGCCCCCCCGAGCCCCCCCTATCCCGCAGCGGCTCCTGGGTCTCCCACGA
CGAGCGCGACTACCTTGAAGGCGTCGACGACGAGCCTCACCGCCCTCTGCCCGAGCCGCCACTCCCCGCCAAGCC
CTCGGCCAGTACTGCCTCTCCTCCCTCCACCGCCGCCACTCCTCGCCCTCTGCCCGACCCAGCAACCTACTCGTC
TCCCGCCTCCTCACCAGCCTCGTCCCGCTCTCTCCCTCGCCCCCGTCCACCCCCAAAGTCGTCTCTCCTCGAGCG
CGAAATGGAACTCGAGCGCCAGCGCCAGCGCGAGTGGGAACAGGCCCAGCAGGAAACCGCCCGTGCTACTCCCGC
TCCCGACGCCGCCGCCACTCTTGGCCTCGGCGGTCGCTGGGACCTGGGTCAGTGGAGTGGCTTCACTGGCGGCGA
CGGCCAGAACCGTGGTTCCCATGGCATTGGCGCCGGCCGCCGACAAATCGTCGGGCCCAGACCCTTGCCCGAAGG
CGGTCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail