Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2185
Gene name
LocationContig_1752:818..2146
Strand-
Gene length (bp)1328
Transcript length (bp)1224
Coding sequence length (bp)1224
Protein length (aa) 408

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.9E-13 183 252

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.05c PE=3 SV=1 96 293 4.0E-44
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 181 326 1.0E-30
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 181 341 2.0E-29
sp|Q7SYS2|MK67I_XENLA MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis GN=nifk PE=2 SV=2 181 326 5.0E-28
sp|P53927|NOP15_YEAST Ribosome biogenesis protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP15 PE=1 SV=1 181 258 6.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74978|YQL5_SCHPO Uncharacterized RNA-binding protein C1827.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.05c PE=3 SV=1 96 293 4.0E-44
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 181 326 1.0E-30
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 181 341 2.0E-29
sp|Q7SYS2|MK67I_XENLA MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis GN=nifk PE=2 SV=2 181 326 5.0E-28
sp|P53927|NOP15_YEAST Ribosome biogenesis protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP15 PE=1 SV=1 181 258 6.0E-27
sp|Q3SZM1|MK67I_BOVIN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus GN=NIFK PE=2 SV=1 181 276 4.0E-26
sp|Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens GN=NIFK PE=1 SV=1 181 276 3.0E-24
sp|Q5RJM0|MK67I_RAT MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Rattus norvegicus GN=Nifk PE=2 SV=1 181 274 1.0E-22
sp|Q91VE6|MK67I_MOUSE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Mus musculus GN=Nifk PE=1 SV=1 180 276 1.0E-22
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 182 254 1.0E-07
sp|Q99383|HRP1_YEAST Nuclear polyadenylated RNA-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRP1 PE=1 SV=1 165 259 2.0E-07
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 181 244 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 65 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2185
MAPELRKRKVLPEAKQDVSTKTKVEGKATTKTKRKAVDEVSPVSLKKQKPAKKTSSQPNKKPAKEAVESKQNQKP
AKKTSSQPNKKPAKAAVESKQPKKTAKPVQITKEEEEIAPKSPVDGSASEDEEDGGVLLLADELDSSDDDATDTT
SLFKPGQDVGNIPAISAEVCKAAIKPAGERGVIYVGRIPHGFYEYEMRQYMSQFGPITRLRLSRNPKTGASRHFA
FIEFEEASTAEIVAKTMNNYLLFGHLLKVKVVPPSELHKDVFKGANTKFKKVPWNKMAGKKLEKPHTKAAWEAKV
GKEQVAREEKLAKLKAIGYEFEAPAFKDVPPPAPKIVESEDQETSAIESAPTLSEAVDGAALPKGQVDQTDKAQE
TETVTTIPPTKTKAKAKAKTSKSTKSKKRAKA*
Coding >OphauG2|2185
ATGGCACCTGAACTCAGGAAACGAAAAGTCCTCCCAGAAGCCAAGCAGGATGTTTCTACAAAAACAAAAGTGGAG
GGAAAAGCGACAACAAAGACCAAGCGAAAAGCTGTCGATGAGGTCTCGCCCGTATCGTTGAAGAAGCAAAAGCCA
GCCAAAAAGACATCGAGCCAGCCCAACAAAAAACCTGCAAAAGAAGCCGTTGAATCCAAGCAGAACCAAAAGCCA
GCCAAAAAGACATCGAGCCAGCCCAACAAAAAGCCTGCAAAAGCAGCCGTTGAATCCAAGCAACCGAAGAAAACT
GCCAAACCAGTCCAAATTACAAAGGAGGAGGAAGAGATCGCTCCAAAGTCTCCCGTGGATGGATCAGCATCCGAG
GACGAAGAAGACGGGGGCGTTTTGCTGCTGGCTGATGAGCTCGACTCGAGCGACGACGATGCTACCGACACCACG
TCCCTGTTCAAGCCCGGGCAGGACGTTGGCAATATACCTGCTATCTCTGCAGAGGTGTGTAAAGCAGCAATAAAG
CCAGCGGGTGAGCGAGGCGTCATTTACGTTGGCCGCATCCCACACGGCTTCTATGAGTACGAAATGAGACAATAC
ATGTCCCAATTTGGCCCCATCACACGGCTTCGACTCTCGCGCAATCCCAAGACGGGTGCAAGCAGGCATTTCGCC
TTTATCGAATTCGAAGAAGCAAGCACAGCCGAAATTGTCGCAAAGACAATGAACAACTACCTGCTCTTTGGGCAT
CTTCTCAAGGTCAAAGTGGTGCCTCCAAGTGAGCTGCACAAGGATGTCTTCAAGGGCGCCAACACCAAGTTCAAA
AAAGTGCCATGGAACAAGATGGCGGGCAAGAAACTGGAGAAGCCGCATACAAAAGCAGCTTGGGAGGCCAAAGTG
GGAAAAGAGCAAGTCGCTCGAGAGGAAAAATTGGCCAAGCTCAAGGCAATTGGCTATGAGTTTGAGGCCCCTGCG
TTCAAAGATGTCCCTCCCCCGGCTCCCAAGATAGTGGAGAGTGAGGACCAGGAGACAAGCGCTATTGAGTCGGCT
CCAACCTTGAGCGAAGCTGTTGATGGGGCGGCTTTGCCCAAAGGTCAGGTCGACCAGACAGACAAGGCACAAGAG
ACAGAGACGGTGACCACAATACCCCCTACAAAGACCAAGGCAAAGGCCAAGGCCAAGACCTCAAAATCTACCAAG
TCGAAGAAGAGGGCAAAGGCCTAA
Transcript >OphauG2|2185
ATGGCACCTGAACTCAGGAAACGAAAAGTCCTCCCAGAAGCCAAGCAGGATGTTTCTACAAAAACAAAAGTGGAG
GGAAAAGCGACAACAAAGACCAAGCGAAAAGCTGTCGATGAGGTCTCGCCCGTATCGTTGAAGAAGCAAAAGCCA
GCCAAAAAGACATCGAGCCAGCCCAACAAAAAACCTGCAAAAGAAGCCGTTGAATCCAAGCAGAACCAAAAGCCA
GCCAAAAAGACATCGAGCCAGCCCAACAAAAAGCCTGCAAAAGCAGCCGTTGAATCCAAGCAACCGAAGAAAACT
GCCAAACCAGTCCAAATTACAAAGGAGGAGGAAGAGATCGCTCCAAAGTCTCCCGTGGATGGATCAGCATCCGAG
GACGAAGAAGACGGGGGCGTTTTGCTGCTGGCTGATGAGCTCGACTCGAGCGACGACGATGCTACCGACACCACG
TCCCTGTTCAAGCCCGGGCAGGACGTTGGCAATATACCTGCTATCTCTGCAGAGGTGTGTAAAGCAGCAATAAAG
CCAGCGGGTGAGCGAGGCGTCATTTACGTTGGCCGCATCCCACACGGCTTCTATGAGTACGAAATGAGACAATAC
ATGTCCCAATTTGGCCCCATCACACGGCTTCGACTCTCGCGCAATCCCAAGACGGGTGCAAGCAGGCATTTCGCC
TTTATCGAATTCGAAGAAGCAAGCACAGCCGAAATTGTCGCAAAGACAATGAACAACTACCTGCTCTTTGGGCAT
CTTCTCAAGGTCAAAGTGGTGCCTCCAAGTGAGCTGCACAAGGATGTCTTCAAGGGCGCCAACACCAAGTTCAAA
AAAGTGCCATGGAACAAGATGGCGGGCAAGAAACTGGAGAAGCCGCATACAAAAGCAGCTTGGGAGGCCAAAGTG
GGAAAAGAGCAAGTCGCTCGAGAGGAAAAATTGGCCAAGCTCAAGGCAATTGGCTATGAGTTTGAGGCCCCTGCG
TTCAAAGATGTCCCTCCCCCGGCTCCCAAGATAGTGGAGAGTGAGGACCAGGAGACAAGCGCTATTGAGTCGGCT
CCAACCTTGAGCGAAGCTGTTGATGGGGCGGCTTTGCCCAAAGGTCAGGTCGACCAGACAGACAAGGCACAAGAG
ACAGAGACGGTGACCACAATACCCCCTACAAAGACCAAGGCAAAGGCCAAGGCCAAGACCTCAAAATCTACCAAG
TCGAAGAAGAGGGCAAAGGCCTAA
Gene >OphauG2|2185
ATGGCACCTGAACTCAGGAAACGAAAAGGTAAATTGCAAATTTCATGCTATGGATATATTTTGCTAACTTGGAAT
AGTCCTCCCAGAAGCCAAGCAGGATGTTTCTACAAAAACAAAAGTGGAGGGAAAAGCGACAACAAAGACCAAGCG
AAAAGGTGAAAGAGACCACACCTTGTAAACTCTCTCGGCTTGCAACTGACCGCCATCTAGCTGTCGATGAGGTCT
CGCCCGTATCGTTGAAGAAGCAAAAGCCAGCCAAAAAGACATCGAGCCAGCCCAACAAAAAACCTGCAAAAGAAG
CCGTTGAATCCAAGCAGAACCAAAAGCCAGCCAAAAAGACATCGAGCCAGCCCAACAAAAAGCCTGCAAAAGCAG
CCGTTGAATCCAAGCAACCGAAGAAAACTGCCAAACCAGTCCAAATTACAAAGGAGGAGGAAGAGATCGCTCCAA
AGTCTCCCGTGGATGGATCAGCATCCGAGGACGAAGAAGACGGGGGCGTTTTGCTGCTGGCTGATGAGCTCGACT
CGAGCGACGACGATGCTACCGACACCACGTCCCTGTTCAAGCCCGGGCAGGACGTTGGCAATATACCTGCTATCT
CTGCAGAGGTGTGTAAAGCAGCAATAAAGCCAGCGGGTGAGCGAGGCGTCATTTACGTTGGCCGCATCCCACACG
GCTTCTATGAGTACGAAATGAGACAATACATGTCCCAATTTGGCCCCATCACACGGCTTCGACTCTCGCGCAATC
CCAAGACGGGTGCAAGCAGGCATTTCGCCTTTATCGAATTCGAAGAAGCAAGCACAGCCGAAATTGTCGCAAAGA
CAATGAACAACTACCTGCTCTTTGGGCATCTTCTCAAGGTCAAAGTGGTGCCTCCAAGTGAGCTGCACAAGGATG
TCTTCAAGGGCGCCAACACCAAGTTCAAAAAAGTGCCATGGAACAAGATGGCGGGCAAGAAACTGGAGAAGCCGC
ATACAAAAGCAGCTTGGGAGGCCAAAGTGGGAAAAGAGCAAGTCGCTCGAGAGGAAAAATTGGCCAAGCTCAAGG
CAATTGGCTATGAGTTTGAGGCCCCTGCGTTCAAAGATGTCCCTCCCCCGGCTCCCAAGATAGTGGAGAGTGAGG
ACCAGGAGACAAGCGCTATTGAGTCGGCTCCAACCTTGAGCGAAGCTGTTGATGGGGCGGCTTTGCCCAAAGGTC
AGGTCGACCAGACAGACAAGGCACAAGAGACAGAGACGGTGACCACAATACCCCCTACAAAGACCAAGGCAAAGG
CCAAGGCCAAGACCTCAAAATCTACCAAGTCGAAGAAGAGGGCAAAGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail