Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2171
Gene name
LocationContig_1742:255..1956
Strand-
Gene length (bp)1701
Transcript length (bp)1701
Coding sequence length (bp)1701
Protein length (aa) 567

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 6.6E-17 57 284
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 3.7E-09 55 167
PF12146 Hydrolase_4 Serine aminopeptidase, S33 3.9E-07 57 198
PF00782 DSPc Dual specificity phosphatase, catalytic domain 3.5E-09 502 557
PF00975 Thioesterase Thioesterase domain 2.0E-06 57 146

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 435 559 3.0E-14
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 435 559 4.0E-14
sp|P87056|YDJ8_SCHPO Abhydrolase domain-containing protein C57A10.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A10.08c PE=3 SV=2 51 245 1.0E-11
sp|Q17607|MCE1_CAEEL mRNA-capping enzyme OS=Caenorhabditis elegans GN=cel-1 PE=1 SV=2 436 560 3.0E-11
sp|P24656|PTP_NPVAC Tyrosine-protein phosphatase OS=Autographa californica nuclear polyhedrosis virus GN=PTP PE=1 SV=2 425 557 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O55236|MCE1_MOUSE mRNA-capping enzyme OS=Mus musculus GN=Rngtt PE=1 SV=1 435 559 3.0E-14
sp|O60942|MCE1_HUMAN mRNA-capping enzyme OS=Homo sapiens GN=RNGTT PE=1 SV=1 435 559 4.0E-14
sp|P87056|YDJ8_SCHPO Abhydrolase domain-containing protein C57A10.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A10.08c PE=3 SV=2 51 245 1.0E-11
sp|Q17607|MCE1_CAEEL mRNA-capping enzyme OS=Caenorhabditis elegans GN=cel-1 PE=1 SV=2 436 560 3.0E-11
sp|P24656|PTP_NPVAC Tyrosine-protein phosphatase OS=Autographa californica nuclear polyhedrosis virus GN=PTP PE=1 SV=2 425 557 5.0E-11
sp|Q6NY98|MCE1_DANRE mRNA-capping enzyme OS=Danio rerio GN=rngtt PE=2 SV=1 435 559 4.0E-10
sp|O10274|PTP1_NPVOP Putative tyrosine-protein phosphatase 1 OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=PTP-1 PE=3 SV=1 430 561 5.0E-09
sp|P38139|LDH1_YEAST Lipid droplet hydrolase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LDH1 PE=1 SV=2 56 237 7.0E-09
sp|Q5E999|DUS11_BOVIN RNA/RNP complex-1-interacting phosphatase OS=Bos taurus GN=DUSP11 PE=2 SV=1 435 564 5.0E-08
sp|P34442|PTP5_CAEEL Probable tyrosine-protein phosphatase F54C8.4 OS=Caenorhabditis elegans GN=F54C8.4 PE=3 SV=1 388 556 1.0E-07
sp|O75319|DUS11_HUMAN RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens GN=DUSP11 PE=1 SV=1 435 555 1.0E-07
sp|Q4KM79|DUS11_RAT RNA/RNP complex-1-interacting phosphatase OS=Rattus norvegicus GN=Dusp11 PE=2 SV=1 435 564 2.0E-07
sp|Q6NXK5|DUS11_MOUSE RNA/RNP complex-1-interacting phosphatase OS=Mus musculus GN=Dusp11 PE=2 SV=1 435 566 3.0E-07
sp|Q9BVJ7|DUS23_HUMAN Dual specificity protein phosphatase 23 OS=Homo sapiens GN=DUSP23 PE=1 SV=1 454 546 5.0E-07
sp|Q6NT99|DUS23_MOUSE Dual specificity protein phosphatase 23 OS=Mus musculus GN=Dusp23 PE=1 SV=1 454 546 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008138 protein tyrosine/serine/threonine phosphatase activity Yes
GO:0009058 biosynthetic process Yes
GO:0016311 dephosphorylation Yes
GO:0004721 phosphoprotein phosphatase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0006793 phosphorus metabolic process No
GO:0016787 hydrolase activity No
GO:0016791 phosphatase activity No
GO:0003674 molecular_function No
GO:0042578 phosphoric ester hydrolase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5552
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2171 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5143
Ophiocordyceps camponoti-floridani Ophcf2|01766
Ophiocordyceps camponoti-rufipedis Ophun1|1004
Ophiocordyceps kimflemingae Ophio5|4967
Ophiocordyceps subramaniannii Hirsu2|709

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2171
MESDSWRTDAHETDPPLLKENSDLYTFKTSRFEYHGIRVFFRQHVKADELPGPLPLLVCIPGLGGSVAQFHPLLS
SLVDLAPCLAVDWPGCGRSEYTVASWDAYTPQAFSELLETVIETYRDSDAGQGVVLIGHSLGTYMAAWMANMHVK
HTTTVARHVVGLVAICPLSGPGDKSKYMWAFLSALFWLPESFLSLWRAWDAMGGLESASVTRFVGQDADAELKML
QYRFNQQSRTPVLRRMAYGLIPSFGDRNPVGGLPGLDIWAGLNIPVYLIAGQDDHLTPPSETEKIVQAIKAASSD
WGTGASPVDFDGTEVPPQPQDPPKVLQSIVMPSPANHTLLYMPQSARALAGLISDFVAANVTGRLSLAWQLQYLS
REGKWDVKNLDKWRSVEPVSDGIGPEGKPIFRALKTLREADEVHCPKVFVEKWGSMIKDVIDISKDQPVYDPRGL
ERSGIHYHKFPTVSKVPPPAHEVESFVRCVDGLREAQQVRAKQENWQGAHEYVIGVHCHYGFNRTGYLIVCYLVE
RCGFGLQDAIDAFAQARPNGIRHSHFLDRLYVRYNIDATRT*
Coding >OphauG2|2171
ATGGAGAGCGACTCATGGCGAACCGATGCGCATGAAACGGATCCTCCTCTGCTTAAAGAGAACTCGGACCTATAC
ACATTCAAGACTAGCCGCTTTGAATACCACGGCATCAGAGTTTTTTTTCGTCAGCATGTCAAGGCCGACGAACTC
CCGGGGCCTCTGCCATTACTTGTGTGCATTCCTGGTCTGGGAGGATCAGTTGCTCAGTTTCATCCTCTCCTGAGC
AGTCTCGTCGACCTTGCCCCATGTCTGGCTGTCGACTGGCCTGGTTGTGGCCGCTCCGAATACACGGTAGCTTCA
TGGGACGCCTATACTCCTCAAGCTTTCTCTGAGCTTCTCGAGACCGTGATTGAGACATACCGGGACTCGGACGCC
GGCCAGGGCGTGGTGCTGATTGGGCATAGTTTGGGCACATACATGGCAGCTTGGATGGCAAACATGCATGTCAAA
CACACCACGACAGTGGCAAGGCATGTTGTCGGTCTGGTCGCCATTTGCCCGCTATCTGGCCCCGGCGACAAATCA
AAGTACATGTGGGCCTTTTTGAGCGCTCTTTTCTGGCTCCCCGAGTCTTTCTTGTCCCTTTGGCGGGCCTGGGAC
GCCATGGGGGGACTCGAGAGTGCCAGTGTGACCCGATTTGTCGGTCAGGATGCAGATGCGGAATTGAAAATGCTC
CAGTACCGCTTCAACCAGCAAAGCCGCACGCCGGTATTGAGGCGTATGGCATATGGCCTCATTCCTTCCTTTGGA
GACAGAAACCCTGTGGGAGGGCTTCCTGGTCTTGATATCTGGGCTGGCTTGAATATACCCGTTTATCTGATTGCT
GGCCAAGATGACCACTTGACACCGCCCAGCGAAACAGAAAAGATTGTCCAAGCAATCAAGGCAGCCTCTTCAGAC
TGGGGCACTGGGGCCTCTCCTGTTGACTTTGACGGCACAGAGGTGCCACCTCAGCCGCAAGATCCGCCCAAAGTG
CTACAAAGCATCGTCATGCCTTCGCCGGCCAACCATACTCTGCTATACATGCCACAATCTGCCAGAGCTCTGGCT
GGCCTCATATCTGACTTTGTCGCCGCAAACGTGACTGGCAGGCTGTCGCTGGCCTGGCAGCTACAGTACCTGTCA
CGCGAGGGCAAGTGGGACGTGAAGAATCTTGACAAGTGGAGGTCTGTGGAACCCGTTTCAGACGGCATTGGACCC
GAGGGAAAGCCCATTTTTCGAGCCCTGAAGACATTGCGCGAGGCAGACGAGGTGCACTGCCCCAAGGTATTTGTT
GAGAAATGGGGTTCTATGATCAAGGATGTCATCGACATCAGCAAGGACCAGCCTGTCTACGACCCGCGCGGCCTG
GAACGCTCAGGAATACACTACCACAAGTTTCCTACTGTGTCCAAGGTGCCACCGCCAGCTCATGAGGTGGAGTCC
TTTGTCCGCTGCGTCGACGGGCTGCGTGAGGCGCAGCAAGTGCGTGCAAAACAAGAGAATTGGCAAGGCGCACAT
GAATACGTTATTGGTGTTCACTGCCACTACGGTTTCAATCGCACCGGCTATTTGATTGTCTGCTACCTTGTTGAG
CGATGTGGCTTTGGTCTACAAGATGCCATTGATGCCTTTGCCCAGGCCCGACCGAATGGCATACGTCACTCTCAT
TTTCTTGACCGGCTTTACGTGCGATACAATATTGATGCGACACGCACATGA
Transcript >OphauG2|2171
ATGGAGAGCGACTCATGGCGAACCGATGCGCATGAAACGGATCCTCCTCTGCTTAAAGAGAACTCGGACCTATAC
ACATTCAAGACTAGCCGCTTTGAATACCACGGCATCAGAGTTTTTTTTCGTCAGCATGTCAAGGCCGACGAACTC
CCGGGGCCTCTGCCATTACTTGTGTGCATTCCTGGTCTGGGAGGATCAGTTGCTCAGTTTCATCCTCTCCTGAGC
AGTCTCGTCGACCTTGCCCCATGTCTGGCTGTCGACTGGCCTGGTTGTGGCCGCTCCGAATACACGGTAGCTTCA
TGGGACGCCTATACTCCTCAAGCTTTCTCTGAGCTTCTCGAGACCGTGATTGAGACATACCGGGACTCGGACGCC
GGCCAGGGCGTGGTGCTGATTGGGCATAGTTTGGGCACATACATGGCAGCTTGGATGGCAAACATGCATGTCAAA
CACACCACGACAGTGGCAAGGCATGTTGTCGGTCTGGTCGCCATTTGCCCGCTATCTGGCCCCGGCGACAAATCA
AAGTACATGTGGGCCTTTTTGAGCGCTCTTTTCTGGCTCCCCGAGTCTTTCTTGTCCCTTTGGCGGGCCTGGGAC
GCCATGGGGGGACTCGAGAGTGCCAGTGTGACCCGATTTGTCGGTCAGGATGCAGATGCGGAATTGAAAATGCTC
CAGTACCGCTTCAACCAGCAAAGCCGCACGCCGGTATTGAGGCGTATGGCATATGGCCTCATTCCTTCCTTTGGA
GACAGAAACCCTGTGGGAGGGCTTCCTGGTCTTGATATCTGGGCTGGCTTGAATATACCCGTTTATCTGATTGCT
GGCCAAGATGACCACTTGACACCGCCCAGCGAAACAGAAAAGATTGTCCAAGCAATCAAGGCAGCCTCTTCAGAC
TGGGGCACTGGGGCCTCTCCTGTTGACTTTGACGGCACAGAGGTGCCACCTCAGCCGCAAGATCCGCCCAAAGTG
CTACAAAGCATCGTCATGCCTTCGCCGGCCAACCATACTCTGCTATACATGCCACAATCTGCCAGAGCTCTGGCT
GGCCTCATATCTGACTTTGTCGCCGCAAACGTGACTGGCAGGCTGTCGCTGGCCTGGCAGCTACAGTACCTGTCA
CGCGAGGGCAAGTGGGACGTGAAGAATCTTGACAAGTGGAGGTCTGTGGAACCCGTTTCAGACGGCATTGGACCC
GAGGGAAAGCCCATTTTTCGAGCCCTGAAGACATTGCGCGAGGCAGACGAGGTGCACTGCCCCAAGGTATTTGTT
GAGAAATGGGGTTCTATGATCAAGGATGTCATCGACATCAGCAAGGACCAGCCTGTCTACGACCCGCGCGGCCTG
GAACGCTCAGGAATACACTACCACAAGTTTCCTACTGTGTCCAAGGTGCCACCGCCAGCTCATGAGGTGGAGTCC
TTTGTCCGCTGCGTCGACGGGCTGCGTGAGGCGCAGCAAGTGCGTGCAAAACAAGAGAATTGGCAAGGCGCACAT
GAATACGTTATTGGTGTTCACTGCCACTACGGTTTCAATCGCACCGGCTATTTGATTGTCTGCTACCTTGTTGAG
CGATGTGGCTTTGGTCTACAAGATGCCATTGATGCCTTTGCCCAGGCCCGACCGAATGGCATACGTCACTCTCAT
TTTCTTGACCGGCTTTACGTGCGATACAATATTGATGCGACACGCACATGA
Gene >OphauG2|2171
ATGGAGAGCGACTCATGGCGAACCGATGCGCATGAAACGGATCCTCCTCTGCTTAAAGAGAACTCGGACCTATAC
ACATTCAAGACTAGCCGCTTTGAATACCACGGCATCAGAGTTTTTTTTCGTCAGCATGTCAAGGCCGACGAACTC
CCGGGGCCTCTGCCATTACTTGTGTGCATTCCTGGTCTGGGAGGATCAGTTGCTCAGTTTCATCCTCTCCTGAGC
AGTCTCGTCGACCTTGCCCCATGTCTGGCTGTCGACTGGCCTGGTTGTGGCCGCTCCGAATACACGGTAGCTTCA
TGGGACGCCTATACTCCTCAAGCTTTCTCTGAGCTTCTCGAGACCGTGATTGAGACATACCGGGACTCGGACGCC
GGCCAGGGCGTGGTGCTGATTGGGCATAGTTTGGGCACATACATGGCAGCTTGGATGGCAAACATGCATGTCAAA
CACACCACGACAGTGGCAAGGCATGTTGTCGGTCTGGTCGCCATTTGCCCGCTATCTGGCCCCGGCGACAAATCA
AAGTACATGTGGGCCTTTTTGAGCGCTCTTTTCTGGCTCCCCGAGTCTTTCTTGTCCCTTTGGCGGGCCTGGGAC
GCCATGGGGGGACTCGAGAGTGCCAGTGTGACCCGATTTGTCGGTCAGGATGCAGATGCGGAATTGAAAATGCTC
CAGTACCGCTTCAACCAGCAAAGCCGCACGCCGGTATTGAGGCGTATGGCATATGGCCTCATTCCTTCCTTTGGA
GACAGAAACCCTGTGGGAGGGCTTCCTGGTCTTGATATCTGGGCTGGCTTGAATATACCCGTTTATCTGATTGCT
GGCCAAGATGACCACTTGACACCGCCCAGCGAAACAGAAAAGATTGTCCAAGCAATCAAGGCAGCCTCTTCAGAC
TGGGGCACTGGGGCCTCTCCTGTTGACTTTGACGGCACAGAGGTGCCACCTCAGCCGCAAGATCCGCCCAAAGTG
CTACAAAGCATCGTCATGCCTTCGCCGGCCAACCATACTCTGCTATACATGCCACAATCTGCCAGAGCTCTGGCT
GGCCTCATATCTGACTTTGTCGCCGCAAACGTGACTGGCAGGCTGTCGCTGGCCTGGCAGCTACAGTACCTGTCA
CGCGAGGGCAAGTGGGACGTGAAGAATCTTGACAAGTGGAGGTCTGTGGAACCCGTTTCAGACGGCATTGGACCC
GAGGGAAAGCCCATTTTTCGAGCCCTGAAGACATTGCGCGAGGCAGACGAGGTGCACTGCCCCAAGGTATTTGTT
GAGAAATGGGGTTCTATGATCAAGGATGTCATCGACATCAGCAAGGACCAGCCTGTCTACGACCCGCGCGGCCTG
GAACGCTCAGGAATACACTACCACAAGTTTCCTACTGTGTCCAAGGTGCCACCGCCAGCTCATGAGGTGGAGTCC
TTTGTCCGCTGCGTCGACGGGCTGCGTGAGGCGCAGCAAGTGCGTGCAAAACAAGAGAATTGGCAAGGCGCACAT
GAATACGTTATTGGTGTTCACTGCCACTACGGTTTCAATCGCACCGGCTATTTGATTGTCTGCTACCTTGTTGAG
CGATGTGGCTTTGGTCTACAAGATGCCATTGATGCCTTTGCCCAGGCCCGACCGAATGGCATACGTCACTCTCAT
TTTCTTGACCGGCTTTACGTGCGATACAATATTGATGCGACACGCACATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail