Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2166
Gene name
LocationContig_174:20370..21009
Strand+
Gene length (bp)639
Transcript length (bp)639
Coding sequence length (bp)639
Protein length (aa) 213

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00881 Nitroreductase Nitroreductase family 5.3E-14 15 182

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96VH4|HBN1_YEAST Putative nitroreductase HBN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBN1 PE=1 SV=1 11 203 1.0E-33
sp|P37261|FRM2_YEAST Fatty acid repression mutant protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRM2 PE=1 SV=2 11 193 1.0E-32

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup477
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1120
Ophiocordyceps australis 1348a (Ghana) OphauG2|2166 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1593
Ophiocordyceps australis map64 (Brazil) OphauB2|659
Ophiocordyceps camponoti-floridani Ophcf2|06109
Ophiocordyceps camponoti-rufipedis Ophun1|5974
Ophiocordyceps kimflemingae Ophio5|268
Ophiocordyceps subramaniannii Hirsu2|10584

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2166
MASKTSADLLLEIARSRRTIYKLNKKLPISHGRVRQLVEQTTLHTPSSFNSQTNRLVVLFGAEHERLWDIASVAL
RGIVPDDRWQHTADRIAMFRAGAGTVLFFSDDDGVKAMQDKFPAYADRFPGWAMQSNGMQQWMLWSALELDGLGA
NLQHYNPIIDAKVAETWKMPTSWKLNAQLVFGGRDGEASQKEFKPLEERIKMFGADADADAA*
Coding >OphauG2|2166
ATGGCTTCCAAGACATCGGCCGATCTTCTCCTCGAGATTGCGCGCTCTCGTCGCACTATTTACAAGCTCAATAAG
AAGCTCCCCATCAGCCATGGCCGGGTGCGCCAACTTGTCGAGCAGACAACGCTGCACACGCCTTCGTCCTTTAAC
TCACAGACAAATCGTCTTGTTGTCCTGTTTGGCGCAGAGCACGAGCGTCTTTGGGACATTGCCTCGGTTGCTCTT
CGCGGCATTGTCCCCGATGATCGATGGCAGCACACGGCCGACCGCATAGCCATGTTCCGTGCCGGCGCTGGCACC
GTTCTTTTCTTCTCTGATGACGATGGCGTCAAGGCCATGCAAGACAAATTCCCTGCCTATGCCGACCGCTTTCCC
GGCTGGGCTATGCAGAGTAACGGCATGCAGCAGTGGATGCTCTGGTCCGCCCTCGAGCTCGACGGCCTAGGTGCC
AACCTCCAACATTATAACCCAATCATCGATGCAAAGGTTGCCGAGACGTGGAAGATGCCTACTAGCTGGAAGCTC
AATGCCCAGCTTGTCTTTGGTGGCAGGGATGGAGAAGCATCGCAAAAGGAATTCAAGCCTCTCGAGGAACGCATC
AAGATGTTTGGTGCTGATGCTGATGCTGATGCTGCCTAG
Transcript >OphauG2|2166
ATGGCTTCCAAGACATCGGCCGATCTTCTCCTCGAGATTGCGCGCTCTCGTCGCACTATTTACAAGCTCAATAAG
AAGCTCCCCATCAGCCATGGCCGGGTGCGCCAACTTGTCGAGCAGACAACGCTGCACACGCCTTCGTCCTTTAAC
TCACAGACAAATCGTCTTGTTGTCCTGTTTGGCGCAGAGCACGAGCGTCTTTGGGACATTGCCTCGGTTGCTCTT
CGCGGCATTGTCCCCGATGATCGATGGCAGCACACGGCCGACCGCATAGCCATGTTCCGTGCCGGCGCTGGCACC
GTTCTTTTCTTCTCTGATGACGATGGCGTCAAGGCCATGCAAGACAAATTCCCTGCCTATGCCGACCGCTTTCCC
GGCTGGGCTATGCAGAGTAACGGCATGCAGCAGTGGATGCTCTGGTCCGCCCTCGAGCTCGACGGCCTAGGTGCC
AACCTCCAACATTATAACCCAATCATCGATGCAAAGGTTGCCGAGACGTGGAAGATGCCTACTAGCTGGAAGCTC
AATGCCCAGCTTGTCTTTGGTGGCAGGGATGGAGAAGCATCGCAAAAGGAATTCAAGCCTCTCGAGGAACGCATC
AAGATGTTTGGTGCTGATGCTGATGCTGATGCTGCCTAG
Gene >OphauG2|2166
ATGGCTTCCAAGACATCGGCCGATCTTCTCCTCGAGATTGCGCGCTCTCGTCGCACTATTTACAAGCTCAATAAG
AAGCTCCCCATCAGCCATGGCCGGGTGCGCCAACTTGTCGAGCAGACAACGCTGCACACGCCTTCGTCCTTTAAC
TCACAGACAAATCGTCTTGTTGTCCTGTTTGGCGCAGAGCACGAGCGTCTTTGGGACATTGCCTCGGTTGCTCTT
CGCGGCATTGTCCCCGATGATCGATGGCAGCACACGGCCGACCGCATAGCCATGTTCCGTGCCGGCGCTGGCACC
GTTCTTTTCTTCTCTGATGACGATGGCGTCAAGGCCATGCAAGACAAATTCCCTGCCTATGCCGACCGCTTTCCC
GGCTGGGCTATGCAGAGTAACGGCATGCAGCAGTGGATGCTCTGGTCCGCCCTCGAGCTCGACGGCCTAGGTGCC
AACCTCCAACATTATAACCCAATCATCGATGCAAAGGTTGCCGAGACGTGGAAGATGCCTACTAGCTGGAAGCTC
AATGCCCAGCTTGTCTTTGGTGGCAGGGATGGAGAAGCATCGCAAAAGGAATTCAAGCCTCTCGAGGAACGCATC
AAGATGTTTGGTGCTGATGCTGATGCTGATGCTGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail