Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2163
Gene name
LocationContig_174:10363..11538
Strand+
Gene length (bp)1175
Transcript length (bp)966
Coding sequence length (bp)966
Protein length (aa) 322

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01269 Fibrillarin Fibrillarin 4.8E-99 81 317
PF08704 GCD14 tRNA methyltransferase complex GCD14 subunit 7.1E-06 158 276

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE26|FBRL_NEUCR rRNA 2'-O-methyltransferase fibrillarin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-1 PE=3 SV=2 78 320 3.0E-123
sp|Q9FEF8|MD36B_ARATH Probable mediator of RNA polymerase II transcription subunit 36b OS=Arabidopsis thaliana GN=MED36B PE=1 SV=1 73 320 5.0E-115
sp|Q94AH9|MD36A_ARATH Mediator of RNA polymerase II transcription subunit 36a OS=Arabidopsis thaliana GN=MED36A PE=1 SV=2 73 320 6.0E-115
sp|P35551|FBRL_SCHPO rRNA 2'-O-methyltransferase fibrillarin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fib1 PE=1 SV=1 77 320 8.0E-115
sp|P22087|FBRL_HUMAN rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens GN=FBL PE=1 SV=2 74 317 4.0E-109
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE26|FBRL_NEUCR rRNA 2'-O-methyltransferase fibrillarin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-1 PE=3 SV=2 78 320 3.0E-123
sp|Q9FEF8|MD36B_ARATH Probable mediator of RNA polymerase II transcription subunit 36b OS=Arabidopsis thaliana GN=MED36B PE=1 SV=1 73 320 5.0E-115
sp|Q94AH9|MD36A_ARATH Mediator of RNA polymerase II transcription subunit 36a OS=Arabidopsis thaliana GN=MED36A PE=1 SV=2 73 320 6.0E-115
sp|P35551|FBRL_SCHPO rRNA 2'-O-methyltransferase fibrillarin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fib1 PE=1 SV=1 77 320 8.0E-115
sp|P22087|FBRL_HUMAN rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens GN=FBL PE=1 SV=2 74 317 4.0E-109
sp|P35550|FBRL_MOUSE rRNA 2'-O-methyltransferase fibrillarin OS=Mus musculus GN=Fbl PE=1 SV=2 74 317 5.0E-109
sp|P22509|FBRL_RAT rRNA 2'-O-methyltransferase fibrillarin OS=Rattus norvegicus GN=Fbl PE=1 SV=2 74 317 6.0E-109
sp|P15646|FBRL_YEAST rRNA 2'-O-methyltransferase fibrillarin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP1 PE=1 SV=1 78 318 1.0E-108
sp|Q6FN88|FBRL_CANGA rRNA 2'-O-methyltransferase fibrillarin OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP1 PE=3 SV=1 78 318 1.0E-108
sp|Q756P0|FBRL_ASHGO rRNA 2'-O-methyltransferase fibrillarin OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP1 PE=3 SV=1 78 318 2.0E-108
sp|P22232|FBRL_XENLA rRNA 2'-O-methyltransferase fibrillarin OS=Xenopus laevis GN=fbl PE=2 SV=1 78 317 3.0E-108
sp|Q8I1F4|FBRL_DROER rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila erecta GN=Fib PE=3 SV=1 79 317 2.0E-106
sp|Q9W1V3|FBRL_DROME rRNA 2'-O-methyltransferase fibrillarin OS=Drosophila melanogaster GN=Fib PE=2 SV=1 79 317 8.0E-106
sp|Q6BQ34|FBRL_DEBHA rRNA 2'-O-methyltransferase fibrillarin OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP1 PE=3 SV=1 78 318 1.0E-105
sp|A6NHQ2|FBLL1_HUMAN rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1 OS=Homo sapiens GN=FBLL1 PE=3 SV=2 74 317 9.0E-105
sp|Q80WS3|FBLL1_MOUSE rRNA/tRNA 2'-O-methyltransferase fibrillarin-like protein 1 OS=Mus musculus GN=Fbll1 PE=2 SV=1 74 317 9.0E-105
sp|Q22053|FBRL_CAEEL rRNA 2'-O-methyltransferase fibrillarin OS=Caenorhabditis elegans GN=fib-1 PE=3 SV=1 79 317 1.0E-102
sp|Q8SR42|FBRL_ENCCU rRNA 2'-O-methyltransferase fibrillarin OS=Encephalitozoon cuniculi (strain GB-M1) GN=NOP1 PE=3 SV=1 55 317 1.0E-100
sp|Q27200|FBRL_TETTH rRNA 2'-O-methyltransferase fibrillarin OS=Tetrahymena thermophila GN=FIB PE=2 SV=2 76 317 1.0E-98
sp|Q55CW0|FBRL_DICDI rRNA 2'-O-methyltransferase fibrillarin OS=Dictyostelium discoideum GN=fbl PE=3 SV=1 66 318 5.0E-98
sp|P35549|FBRL_LEIMA rRNA 2'-O-methyltransferase fibrillarin OS=Leishmania major PE=3 SV=1 75 317 5.0E-88
sp|Q9FHB3|FBRL3_ARATH Putative rRNA 2'-O-methyltransferase fibrillarin 3 OS=Arabidopsis thaliana GN=FIB3 PE=2 SV=1 72 317 9.0E-87
sp|Q24957|FBRL_GIAIN rRNA 2'-O-methyltransferase fibrillarin OS=Giardia intestinalis PE=3 SV=1 73 317 6.0E-83
sp|C5A403|FLPA_THEGJ Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=flpA PE=3 SV=1 81 311 1.0E-60
sp|B6YXH6|FLPA_THEON Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermococcus onnurineus (strain NA1) GN=flpA PE=3 SV=1 81 311 2.0E-60
sp|Q5JFN1|FLPA_THEKO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=flpA PE=3 SV=1 81 311 4.0E-60
sp|C6A2L3|FLPA_THESM Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=flpA PE=3 SV=1 81 313 2.0E-58
sp|Q9V2L5|FLPA_PYRAB Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=flpA PE=3 SV=1 81 311 2.0E-58
sp|A3DNY7|FLPA_STAMF Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=flpA PE=3 SV=1 79 318 8.0E-58
sp|Q8U4M2|FLPA_PYRFU Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=flpA PE=1 SV=1 81 311 1.0E-57
sp|O57811|FLPA_PYRHO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=flpA PE=1 SV=1 79 311 3.0E-57
sp|Q9Y9U3|FLPA_AERPE Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=flpA PE=1 SV=1 82 318 9.0E-57
sp|P58032|FLPA_SULSO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=flpA PE=1 SV=1 100 317 2.0E-55
sp|A4WKL2|FLPA_PYRAR Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=flpA PE=3 SV=1 79 312 5.0E-55
sp|A3MV65|FLPA_PYRCJ Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=flpA PE=3 SV=1 79 314 5.0E-55
sp|Q8ZTI9|FLPA_PYRAE Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=flpA PE=3 SV=1 79 312 9.0E-55
sp|C3N5E4|FLPA_SULIA Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain M.16.27) GN=flpA PE=3 SV=1 100 317 3.0E-54
sp|C3NHQ5|FLPA_SULIN Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=flpA PE=3 SV=1 100 317 3.0E-54
sp|C4KH10|FLPA_SULIK Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=flpA PE=3 SV=1 100 317 3.0E-54
sp|C3MYR2|FLPA_SULIM Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=flpA PE=3 SV=1 100 317 3.0E-54
sp|C3MPR8|FLPA_SULIL Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=flpA PE=3 SV=1 100 317 3.0E-54
sp|C3NDZ8|FLPA_SULIY Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=flpA PE=3 SV=1 100 317 3.0E-54
sp|A9A6C8|FLPA_METM6 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=flpA PE=3 SV=1 100 317 8.0E-54
sp|A1RRJ7|FLPA_PYRIL Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=flpA PE=3 SV=1 85 314 1.0E-53
sp|A6VJQ1|FLPA_METM7 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=flpA PE=3 SV=1 100 320 4.0E-53
sp|B1YAJ6|FLPA_PYRNV Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=flpA PE=3 SV=1 79 314 6.0E-53
sp|Q6LZM7|FLPA_METMP Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus maripaludis (strain S2 / LL) GN=flpA PE=3 SV=1 100 317 7.0E-53
sp|A4FYN1|FLPA_METM5 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=flpA PE=3 SV=1 100 317 8.0E-53
sp|Q58108|FLPA_METJA Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=flpA PE=1 SV=1 100 317 6.0E-52
sp|Q46EB1|FLPA_METBF Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=flpA PE=3 SV=1 88 310 7.0E-52
sp|A6UV22|FLPA_META3 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=flpA PE=3 SV=1 100 319 1.0E-51
sp|Q971W2|FLPA_SULTO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=flpA PE=3 SV=2 100 317 2.0E-51
sp|P35553|FLPA_METVO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus voltae GN=flpA PE=3 SV=1 100 317 3.0E-51
sp|P0CW09|FLPA_METMA Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=flpA PE=3 SV=1 88 310 9.0E-51
sp|P35552|FLPA_METVS Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=flpA PE=3 SV=1 100 317 3.0E-50
sp|Q8TTT4|FLPA_METAC Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=flpA PE=3 SV=1 88 310 1.0E-48
sp|Q9P9M0|FLPA_SULAC Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=flpA PE=3 SV=1 100 317 1.0E-47
sp|P0CW08|FLPA_METMZ Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase (Fragment) OS=Methanosarcina mazei GN=flpA PE=3 SV=1 88 287 1.0E-47
sp|Q8TXU9|FLPA_METKA Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=flpA PE=3 SV=1 77 317 3.0E-46
sp|Q74N89|FLPA_NANEQ Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Nanoarchaeum equitans (strain Kin4-M) GN=flpA PE=3 SV=1 81 311 6.0E-46
sp|Q9HH35|FLPA_METWO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanothermobacter wolfeii GN=flpA PE=3 SV=1 88 318 2.0E-45
sp|O28192|FLPA_ARCFU Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=flpA PE=1 SV=1 137 312 1.0E-43
sp|O27283|FLPA_METTH Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=flpA PE=3 SV=1 136 312 2.0E-43
sp|A0B6X7|FLPA_METTP Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=flpA PE=3 SV=1 87 314 2.0E-37
sp|A3CSX5|FLPA_METMJ Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=flpA PE=3 SV=1 137 313 3.0E-34
sp|Q9HJL8|FLPA_THEAC Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=flpA PE=3 SV=1 137 312 2.0E-31
sp|Q979P2|FLPA_THEVO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=flpA PE=3 SV=1 87 313 4.0E-31
sp|B9LMQ1|FLPA_HALLT Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=flpA PE=3 SV=1 137 310 8.0E-30
sp|Q9HQG3|FLPA_HALSA Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=flpA PE=3 SV=1 95 312 5.0E-29
sp|B0R515|FLPA_HALS3 Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=flpA PE=3 SV=1 95 312 5.0E-29
sp|Q5V3Q6|FLPA_HALMA Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=flpA PE=3 SV=1 136 310 6.0E-28
sp|Q18H64|FLPA_HALWD Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=flpA PE=3 SV=1 110 314 5.0E-27
sp|Q2FRP5|FLPA_METHJ Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=flpA PE=3 SV=1 138 321 3.0E-24
sp|Q6KZQ5|FLPA_PICTO Fibrillarin-like rRNA/tRNA 2'-O-methyltransferase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=flpA PE=3 SV=1 107 256 1.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0016429 tRNA (adenine-N1-)-methyltransferase activity Yes
GO:0008168 methyltransferase activity Yes
GO:0030488 tRNA methylation Yes
GO:0003723 RNA binding Yes
GO:0006364 rRNA processing Yes
GO:0031515 tRNA (m1A) methyltransferase complex Yes
GO:0006399 tRNA metabolic process No
GO:0008033 tRNA processing No
GO:0008152 metabolic process No
GO:0008757 S-adenosylmethionine-dependent methyltransferase activity No
GO:0032991 protein-containing complex No
GO:0006400 tRNA modification No
GO:0043412 macromolecule modification No
GO:0009451 RNA modification No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0005575 cellular_component No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:0008175 tRNA methyltransferase activity No
GO:0001510 RNA methylation No
GO:0016072 rRNA metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0034708 methyltransferase complex No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0003676 nucleic acid binding No
GO:0008173 RNA methyltransferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0043414 macromolecule methylation No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0044260 cellular macromolecule metabolic process No
GO:1902494 catalytic complex No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0032259 methylation No
GO:0034470 ncRNA processing No
GO:0043527 tRNA methyltransferase complex No
GO:0016740 transferase activity No
GO:0016426 tRNA (adenine) methyltransferase activity No
GO:1990234 transferase complex No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009987 cellular process No
GO:0140098 catalytic activity, acting on RNA No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1285
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2163 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|656
Ophiocordyceps camponoti-floridani Ophcf2|06104
Ophiocordyceps camponoti-rufipedis Ophun1|5978
Ophiocordyceps kimflemingae Ophio5|7762
Ophiocordyceps subramaniannii Hirsu2|10580

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2163
MALGARGGAPRGGPRGGMRGGARGGRGGRGGFGDRGGRGGGFGGRGGARGGPRGGGRGARGGRGGARGGKPGMKG
GAKVIVEPHRHPGVFVVRGGKEDGIATRNMVLSESVYGEKRIQHDETVENEDGTTTTTKVEYRMWNPFRSKLCAA
IAGGADEIYMRPGSRVLYLGAASGTSVSHVADIVGPTGYVYAVEFSSRSGRDLIAMASKRTNVVPIVEDARQPAR
YRMIVPMVDVIFADVAQPDQARIVGVNANWFLKTGGGVLISIKANCIDSTAPPAEVFANEVNKMRAEQIKPKFQL
TLEPFERDHCLVAGIYQRHKS*
Coding >OphauG2|2163
ATGGCATTGGGCGCTCGTGGTGGTGCCCCTCGTGGCGGCCCCCGCGGTGGGATGCGAGGAGGTGCACGTGGCGGC
CGCGGCGGACGTGGCGGCTTTGGCGATCGTGGCGGGCGTGGCGGCGGCTTTGGTGGCCGTGGTGGCGCCAGAGGT
GGTCCGCGCGGTGGTGGACGAGGAGCGCGAGGCGGGCGGGGGGGCGCCAGAGGCGGTAAGCCAGGCATGAAGGGT
GGCGCCAAGGTGATTGTGGAACCTCATCGTCATCCGGGTGTCTTTGTGGTTCGCGGCGGCAAGGAAGATGGCATC
GCGACGCGCAACATGGTCTTGAGCGAGTCCGTCTACGGTGAAAAGCGCATTCAGCACGACGAAACTGTAGAAAAC
GAAGATGGCACAACAACAACGACCAAAGTGGAATATCGAATGTGGAATCCCTTTCGCAGCAAGTTGTGTGCTGCC
ATTGCTGGCGGTGCCGACGAGATTTATATGCGCCCTGGCTCCCGTGTTCTCTACCTGGGTGCTGCTTCAGGAACG
TCTGTATCGCACGTGGCCGATATTGTTGGCCCTACGGGCTATGTATATGCTGTCGAATTCTCGTCTCGGTCTGGA
CGTGATTTGATCGCCATGGCATCGAAGCGAACAAATGTGGTACCAATTGTGGAAGATGCCCGACAGCCCGCACGA
TACCGCATGATTGTTCCCATGGTGGACGTCATCTTTGCCGATGTGGCTCAACCTGATCAAGCTCGGATCGTAGGC
GTCAATGCCAACTGGTTCCTCAAAACCGGTGGCGGTGTTCTCATATCAATCAAGGCCAACTGCATTGACTCTACT
GCTCCTCCTGCAGAAGTCTTTGCCAATGAAGTCAACAAGATGAGGGCGGAGCAGATCAAGCCCAAATTTCAGCTT
ACACTAGAACCATTTGAGCGGGACCACTGCCTGGTTGCCGGCATATATCAGCGCCACAAGTCGTGA
Transcript >OphauG2|2163
ATGGCATTGGGCGCTCGTGGTGGTGCCCCTCGTGGCGGCCCCCGCGGTGGGATGCGAGGAGGTGCACGTGGCGGC
CGCGGCGGACGTGGCGGCTTTGGCGATCGTGGCGGGCGTGGCGGCGGCTTTGGTGGCCGTGGTGGCGCCAGAGGT
GGTCCGCGCGGTGGTGGACGAGGAGCGCGAGGCGGGCGGGGGGGCGCCAGAGGCGGTAAGCCAGGCATGAAGGGT
GGCGCCAAGGTGATTGTGGAACCTCATCGTCATCCGGGTGTCTTTGTGGTTCGCGGCGGCAAGGAAGATGGCATC
GCGACGCGCAACATGGTCTTGAGCGAGTCCGTCTACGGTGAAAAGCGCATTCAGCACGACGAAACTGTAGAAAAC
GAAGATGGCACAACAACAACGACCAAAGTGGAATATCGAATGTGGAATCCCTTTCGCAGCAAGTTGTGTGCTGCC
ATTGCTGGCGGTGCCGACGAGATTTATATGCGCCCTGGCTCCCGTGTTCTCTACCTGGGTGCTGCTTCAGGAACG
TCTGTATCGCACGTGGCCGATATTGTTGGCCCTACGGGCTATGTATATGCTGTCGAATTCTCGTCTCGGTCTGGA
CGTGATTTGATCGCCATGGCATCGAAGCGAACAAATGTGGTACCAATTGTGGAAGATGCCCGACAGCCCGCACGA
TACCGCATGATTGTTCCCATGGTGGACGTCATCTTTGCCGATGTGGCTCAACCTGATCAAGCTCGGATCGTAGGC
GTCAATGCCAACTGGTTCCTCAAAACCGGTGGCGGTGTTCTCATATCAATCAAGGCCAACTGCATTGACTCTACT
GCTCCTCCTGCAGAAGTCTTTGCCAATGAAGTCAACAAGATGAGGGCGGAGCAGATCAAGCCCAAATTTCAGCTT
ACACTAGAACCATTTGAGCGGGACCACTGCCTGGTTGCCGGCATATATCAGCGCCACAAGTCGTGA
Gene >OphauG2|2163
ATGGCATTGGGCGCTCGTGGTGGTGCCCCTCGTGGCGGCCCCCGCGGTGGGATGCGAGGAGGTGCACGTGGCGGC
CGCGGCGGACGTGGCGGCTTTGGCGATCGTGGCGGGCGTGGCGGCGGCTTTGGTGGCCGTGGTGGCGCCAGAGGT
ACGAGATGAAGAAAACTCGAGGCATTGTCTCGCACCACCTTGACTCGAATCTCCCAACTGATTAGAAATCGAATA
GGTGGTCCGCGCGGTGGTGGACGAGGAGCGCGAGGCGGGCGGGGGGGCGCCAGAGGCGGTAAGCCAGGCATGAAG
GGTGGCGCCAAGGTGATTGTGGTAGGTTCTTTTGCAGCTCGGTGTTTCCCAAATCATGCTGCCATGGGCAATGTC
TAATCTTCCTTGCAGGAACCTCATCGTCATCCGGGTGTCTTTGTGGTTCGCGGCGGCAAGGAAGATGGCATCGCG
ACGCGCAACATGGTCTTGAGCGAGTCCGTCTACGGTGAAAAGCGCATTCAGCACGACGAAACTGTAGAAAACGAA
GATGGCACAACAACAACGACCAAAGTGGAATATCGAATGTGGAATCCCTTTCGCAGCAAGTTGTGTGCTGCCATT
GCTGGCGGTGCCGACGAGATTTATATGCGCCCTGGCTCCCGTGTTCTCTACCTGGGTGCTGCTTCAGGAACGTCT
GTATCGCACGTGGCCGATATTGTTGGCCCTACGGGCTATGTATATGCTGTCGAATTCTCGTCTCGGTCTGGACGT
GATTTGATCGCCATGGCATCGAAGCGAACAAATGTGGTACCAATTGTGGAAGATGCCCGACAGCCCGCACGATAC
CGCATGATTGTTCCCATGGTGGACGTCATCTTTGCCGATGTGGCTCAACCTGATCAAGCTCGGATCGTAGGCGTC
AATGCCAACTGGTTCCTCAAAACCGGTGGCGGTGTTCTCATATCAATCAAGGCCAACTGCATTGACTCTACTGCT
CCTCCTGCAGAAGTCTTTGCCAATGAAGTCAACAAGATGAGGGCGGAGCAGATCAAGCCCAAATTTCAGCTTACA
CTAGGCAAGTTTCACGAATCCTCTTGGCCCAAGTTCGAGAGCCACAACTAACTGGCTGATATGCAGAACCATTTG
AGCGGGACCACTGCCTGGTTGCCGGCATATATCAGCGCCACAAGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail