Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2158
Gene name
LocationContig_1739:730..2234
Strand+
Gene length (bp)1504
Transcript length (bp)1422
Coding sequence length (bp)1422
Protein length (aa) 474

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 1.1E-24 35 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 34 207 4.0E-10
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 35 199 3.0E-09
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 35 199 2.0E-08
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 36 199 2.0E-08
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 35 199 8.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A2PU44|CHELT_VIBCL NAD(+)--arginine ADP-ribosyltransferase Chelt OS=Vibrio cholerae GN=A51_B1772 PE=1 SV=1 34 207 4.0E-10
sp|P01555|CHTA_VIBCH Cholera enterotoxin subunit A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ctxA PE=1 SV=1 35 199 3.0E-09
sp|P43530|ELAH_ECOH1 Heat-labile enterotoxin A chain OS=Escherichia coli O78:H11 (strain H10407 / ETEC) GN=eltA PE=3 SV=1 35 199 2.0E-08
sp|P06717|ELAP_ECOLX Heat-labile enterotoxin A chain OS=Escherichia coli GN=eltA PE=1 SV=1 36 199 2.0E-08
sp|P13810|E2AA_ECOLX Heat-labile enterotoxin IIA, A chain OS=Escherichia coli PE=3 SV=1 35 199 8.0E-07
sp|P43528|E2BA_ECOLX Heat-labile enterotoxin IIB, A chain OS=Escherichia coli PE=1 SV=2 35 213 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.991869

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup18
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2158 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|1597
Ophiocordyceps australis 1348a (Ghana) OphauG2|2157
Ophiocordyceps australis 1348a (Ghana) OphauG2|6560
Ophiocordyceps australis 1348a (Ghana) OphauG2|5277
Ophiocordyceps australis 1348a (Ghana) OphauG2|5856
Ophiocordyceps australis 1348a (Ghana) OphauG2|6196
Ophiocordyceps australis map64 (Brazil) OphauB2|3461
Ophiocordyceps australis map64 (Brazil) OphauB2|3472
Ophiocordyceps australis map64 (Brazil) OphauB2|3475
Ophiocordyceps australis map64 (Brazil) OphauB2|7869
Ophiocordyceps camponoti-floridani Ophcf2|03758
Ophiocordyceps camponoti-rufipedis Ophun1|5692
Ophiocordyceps camponoti-rufipedis Ophun1|3301
Ophiocordyceps kimflemingae Ophio5|373
Ophiocordyceps kimflemingae Ophio5|6913
Ophiocordyceps subramaniannii Hirsu2|6613
Ophiocordyceps subramaniannii Hirsu2|3357

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2158
MHHHRLFSVSTALLWSLCFTPTHCGPPSQQRPPAEVWRGDKASPADIRSRGGFLPQNPTMQDDGAFSIFRHMGGE
SKVGAPSRNSPYVPSSIRQDVAETFVRDKNGYIYKIHATPNFIDIWHTLTGEFYLERYEREYAALGGIRWDQIMG
WIHLPNGNTTPQKNRKFTANPEYNHKYDEYCSSGGQPQLAGFPPRHEAWSLEMFKKFKGQKSLGQYAMDFMAENG
AIVGWRGHAPLFYMPVRAKQGVAEAFKAAQDAVRATEKAMNGQDLESVSIESAKARLAAGRAYRAAQKVAETIDN
QPFLKRKLFDEAWVSVVRAKRASLKATVEEERRWLGRFRDEARDARKKAERAKDGTVKAQGPIADEALRAAQTWV
DKVREELKASKQAKLELGDRLRQMEHNSIATGRIQVGRIRVMSKESEIDALKRHLDETMAEITFYREKAKGLEKL
LLRTKASVVKVHQAIDKWEKKER*
Coding >OphauG2|2158
ATGCATCACCACCGCCTCTTTTCCGTCTCGACCGCTCTCCTGTGGTCACTATGCTTCACTCCCACTCATTGCGGC
CCTCCGTCGCAACAGCGTCCGCCTGCAGAGGTATGGCGTGGCGACAAGGCCTCTCCCGCAGACATTCGGTCTCGC
GGCGGCTTCCTGCCGCAGAATCCGACAATGCAAGACGACGGGGCCTTTAGCATCTTTCGCCACATGGGCGGCGAG
TCCAAAGTGGGAGCGCCCAGCCGCAATTCGCCGTATGTGCCGTCATCGATCCGCCAAGATGTGGCTGAGACGTTT
GTGCGAGACAAGAATGGATATATTTACAAAATCCATGCCACGCCGAATTTCATAGACATTTGGCATACTCTGACT
GGGGAGTTTTACCTTGAGAGATATGAGAGAGAGTATGCTGCTTTGGGAGGCATCCGGTGGGACCAAATCATGGGC
TGGATCCATCTGCCCAACGGAAACACGACGCCTCAAAAAAACAGAAAGTTTACTGCCAACCCAGAATACAATCAC
AAATACGATGAATATTGCTCCAGCGGCGGCCAGCCTCAGCTTGCAGGCTTTCCCCCGAGGCACGAGGCTTGGAGC
TTGGAAATGTTCAAAAAGTTCAAAGGGCAGAAATCTCTTGGTCAGTATGCCATGGACTTTATGGCTGAAAACGGC
GCCATTGTTGGCTGGCGTGGACATGCTCCTCTCTTCTACATGCCCGTGCGCGCAAAACAAGGAGTGGCAGAGGCA
TTCAAAGCGGCTCAAGACGCGGTCCGAGCGACTGAAAAGGCCATGAATGGGCAGGACTTGGAAAGCGTTTCCATA
GAAAGCGCCAAGGCAAGACTGGCAGCCGGTAGAGCCTACAGGGCAGCGCAAAAGGTGGCAGAGACGATTGATAAC
CAGCCTTTTCTGAAGAGGAAGCTTTTTGACGAGGCCTGGGTTTCAGTGGTGAGGGCAAAACGGGCCTCTCTCAAG
GCCACGGTAGAGGAAGAGCGGAGATGGCTTGGGCGATTCCGCGACGAAGCAAGAGATGCCAGGAAAAAGGCTGAG
AGGGCCAAGGACGGCACGGTCAAAGCACAAGGCCCAATAGCAGATGAAGCCCTCAGGGCAGCTCAGACATGGGTG
GACAAGGTCAGAGAGGAGCTCAAGGCGAGCAAACAAGCCAAACTCGAGCTCGGCGACAGGCTGAGGCAAATGGAG
CATAATTCGATTGCGACAGGGCGGATACAAGTCGGCCGCATCCGCGTCATGAGCAAAGAGTCGGAAATCGACGCG
CTCAAGCGCCACCTGGACGAAACCATGGCGGAAATCACGTTTTACAGAGAAAAGGCCAAAGGGTTGGAGAAGCTT
CTGCTCCGGACAAAGGCCAGTGTGGTCAAGGTACACCAGGCGATTGACAAGTGGGAGAAGAAGGAGCGATGA
Transcript >OphauG2|2158
ATGCATCACCACCGCCTCTTTTCCGTCTCGACCGCTCTCCTGTGGTCACTATGCTTCACTCCCACTCATTGCGGC
CCTCCGTCGCAACAGCGTCCGCCTGCAGAGGTATGGCGTGGCGACAAGGCCTCTCCCGCAGACATTCGGTCTCGC
GGCGGCTTCCTGCCGCAGAATCCGACAATGCAAGACGACGGGGCCTTTAGCATCTTTCGCCACATGGGCGGCGAG
TCCAAAGTGGGAGCGCCCAGCCGCAATTCGCCGTATGTGCCGTCATCGATCCGCCAAGATGTGGCTGAGACGTTT
GTGCGAGACAAGAATGGATATATTTACAAAATCCATGCCACGCCGAATTTCATAGACATTTGGCATACTCTGACT
GGGGAGTTTTACCTTGAGAGATATGAGAGAGAGTATGCTGCTTTGGGAGGCATCCGGTGGGACCAAATCATGGGC
TGGATCCATCTGCCCAACGGAAACACGACGCCTCAAAAAAACAGAAAGTTTACTGCCAACCCAGAATACAATCAC
AAATACGATGAATATTGCTCCAGCGGCGGCCAGCCTCAGCTTGCAGGCTTTCCCCCGAGGCACGAGGCTTGGAGC
TTGGAAATGTTCAAAAAGTTCAAAGGGCAGAAATCTCTTGGTCAGTATGCCATGGACTTTATGGCTGAAAACGGC
GCCATTGTTGGCTGGCGTGGACATGCTCCTCTCTTCTACATGCCCGTGCGCGCAAAACAAGGAGTGGCAGAGGCA
TTCAAAGCGGCTCAAGACGCGGTCCGAGCGACTGAAAAGGCCATGAATGGGCAGGACTTGGAAAGCGTTTCCATA
GAAAGCGCCAAGGCAAGACTGGCAGCCGGTAGAGCCTACAGGGCAGCGCAAAAGGTGGCAGAGACGATTGATAAC
CAGCCTTTTCTGAAGAGGAAGCTTTTTGACGAGGCCTGGGTTTCAGTGGTGAGGGCAAAACGGGCCTCTCTCAAG
GCCACGGTAGAGGAAGAGCGGAGATGGCTTGGGCGATTCCGCGACGAAGCAAGAGATGCCAGGAAAAAGGCTGAG
AGGGCCAAGGACGGCACGGTCAAAGCACAAGGCCCAATAGCAGATGAAGCCCTCAGGGCAGCTCAGACATGGGTG
GACAAGGTCAGAGAGGAGCTCAAGGCGAGCAAACAAGCCAAACTCGAGCTCGGCGACAGGCTGAGGCAAATGGAG
CATAATTCGATTGCGACAGGGCGGATACAAGTCGGCCGCATCCGCGTCATGAGCAAAGAGTCGGAAATCGACGCG
CTCAAGCGCCACCTGGACGAAACCATGGCGGAAATCACGTTTTACAGAGAAAAGGCCAAAGGGTTGGAGAAGCTT
CTGCTCCGGACAAAGGCCAGTGTGGTCAAGGTACACCAGGCGATTGACAAGTGGGAGAAGAAGGAGCGATGA
Gene >OphauG2|2158
ATGCATCACCACCGCCTCTTTTCCGTCTCGACCGCTCTCCTGTGGTCACTATGCTTCACTCCCACTCATTGCGGC
CCTCCGTCGCAACAGCGTCCGCCTGCAGAGGTATGGCGTGGCGACAAGGCCTCTCCCGCAGACATTCGGTCTCGC
GGCGGCTTCCTGCCGCAGAATCCGACAATGCAAGACGACGGGGCCTTTAGCATCTTTCGCCACATGGGCGGCGAG
TCCAAAGTGGGAGCGCCCAGCCGCAATTCGCCGTATGTGCCGTCATCGATCCGCCAAGATGTGGCTGAGACGTTT
GTGCGAGACAAGAATGGATATATTTACAAAATCCATGCCACGCCGAATTTCATAGACATTTGGCATACTCTGACT
GGGGAGTTTTACCTTGAGAGATATGAGAGAGAGTATGCTGCTTTGGGAGGCATCCGGTGGGACCAAATCATGGGC
TGGATCCATCTGCCCAACGGAAACACGACGCCTCAAAAAAACAGAAAGTTTACTGCCAACCCAGAATACAATCAC
AAATACGATGAATATTGCTCCAGCGGCGGCCAGCCTCAGCTTGCAGGCTTTCCCCCGAGGCACGAGGCTTGGAGC
TTGGAAATGTTCAAAAAGTTCAAAGGGCAGAAATCTCTTGGTCAGTATGCCATGGACTTTATGGCTGAAAACGGC
GCCATTGTTGGCTGGCGTGGACATGCTCCTCTCTTCTACATGCCCGTGCGCGCAAAACAAGGAGTGGCAGAGGCA
TTCAAAGCGGCTCAAGACGCGGTCCGAGCGACTGAAAAGGCCATGAATGGGCAGGACTTGGAAAGCGTTTCCATA
GAAAGCGCCAAGGCAAGACTGGCAGCCGGTAGAGCCTACAGGGCAGCGCAAAAGGTGGCAGAGACGATTGATAAC
CAGCCTTTTCTGAAGAGGAAGCTTTTTGACGAGGCCTGGGTTTCAGTGGTGAGGGCAAAACGGGCCTCTCTCAAG
GCCACGGTAGAGGAAGAGCGGAGATGGCTTGGGCGATTCCGCGACGAAGCAAGAGATGCCAGGAAAAAGGCTGAG
AGGGCCAAGGACGGCACGGTCAAAGCACAAGGCCCAATAGCAGATGAAGCCCTCAGGGCAGCTCAGACATGGGTG
GACAAGGTCAGAGAGGAGCTCAAGGCGAGCAAACAAGCCAAACTCGAGCTCGGCGACAGGCTGAGGCAAATGGAG
CATAATTCGATTGCGACAGGGCGGATACAAGTCGGCCGCATCCGCGTCATGAGCAAAGAGTCGGAAATCGACGCG
CTCAAGCGCCACCTGGACGAAACCATGGCGGAAATCACGTTTTACAGAGAAAAGGCCAAAGGGTTGGAGAAGCTT
CTGCTCCGGACAAAGGCCAGTGTGGTCAAGGTACACCAGGCGATTGACAAGTGGGAGAAGAAGGAGTCGCATGAA
AAACAACGCACCCAGGAGAAACAGGACAAGAAGATGCGGCAAAAGCAGAAACAAGCTGACAAGAAGAAGAAGGCG
ATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail