Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2157
Gene name
LocationContig_1738:1566..2064
Strand+
Gene length (bp)498
Transcript length (bp)498
Coding sequence length (bp)498
Protein length (aa) 166

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01375 Enterotoxin_a Heat-labile enterotoxin alpha chain 2.0E-11 1 98

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005615 extracellular space Yes
GO:0090729 toxin activity Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup18
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2158
Ophiocordyceps australis 1348a (Ghana) OphauG2|1597
Ophiocordyceps australis 1348a (Ghana) OphauG2|2157 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|6560
Ophiocordyceps australis 1348a (Ghana) OphauG2|5277
Ophiocordyceps australis 1348a (Ghana) OphauG2|5856
Ophiocordyceps australis 1348a (Ghana) OphauG2|6196
Ophiocordyceps australis map64 (Brazil) OphauB2|3461
Ophiocordyceps australis map64 (Brazil) OphauB2|3472
Ophiocordyceps australis map64 (Brazil) OphauB2|3475
Ophiocordyceps australis map64 (Brazil) OphauB2|7869
Ophiocordyceps camponoti-floridani Ophcf2|03758
Ophiocordyceps camponoti-rufipedis Ophun1|5692
Ophiocordyceps camponoti-rufipedis Ophun1|3301
Ophiocordyceps kimflemingae Ophio5|373
Ophiocordyceps kimflemingae Ophio5|6913
Ophiocordyceps subramaniannii Hirsu2|6613
Ophiocordyceps subramaniannii Hirsu2|3357

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2157
MIKLSDSLLQFDEYPEEDEYTAMGGILWEQVYGWIRLPNNYEAMTTEQLKNGESNFYDMARKHLAFNRDYNSNKF
KGQPASGGQLRLAGAPQSEWPWSYYQNKPLREAALEFMQEMGGVVDWHGDFPLIAPRPWVKSIEVANEPSTWLDE
NVNEVPRPLVGVDMI*
Coding >OphauG2|2157
ATGATCAAACTGAGCGATTCGCTGCTGCAGTTTGACGAGTATCCAGAGGAAGACGAGTATACGGCCATGGGCGGC
ATTCTGTGGGAGCAGGTCTATGGCTGGATTCGGTTGCCGAATAATTACGAGGCAATGACCACGGAGCAACTGAAA
AATGGAGAATCAAACTTTTACGACATGGCTCGTAAGCATCTTGCCTTCAATCGAGATTACAACAGCAACAAGTTC
AAGGGGCAGCCAGCTAGCGGGGGGCAACTACGACTAGCGGGGGCGCCACAATCAGAATGGCCATGGAGTTATTAC
CAAAATAAGCCTTTGCGGGAAGCAGCTTTGGAATTCATGCAGGAAATGGGCGGGGTTGTGGATTGGCATGGCGAT
TTCCCCTTGATCGCCCCTAGGCCATGGGTGAAGAGCATTGAGGTCGCCAATGAGCCATCGACTTGGCTCGACGAG
AATGTGAATGAGGTGCCTCGACCATTAGTTGGTGTAGACATGATATGA
Transcript >OphauG2|2157
ATGATCAAACTGAGCGATTCGCTGCTGCAGTTTGACGAGTATCCAGAGGAAGACGAGTATACGGCCATGGGCGGC
ATTCTGTGGGAGCAGGTCTATGGCTGGATTCGGTTGCCGAATAATTACGAGGCAATGACCACGGAGCAACTGAAA
AATGGAGAATCAAACTTTTACGACATGGCTCGTAAGCATCTTGCCTTCAATCGAGATTACAACAGCAACAAGTTC
AAGGGGCAGCCAGCTAGCGGGGGGCAACTACGACTAGCGGGGGCGCCACAATCAGAATGGCCATGGAGTTATTAC
CAAAATAAGCCTTTGCGGGAAGCAGCTTTGGAATTCATGCAGGAAATGGGCGGGGTTGTGGATTGGCATGGCGAT
TTCCCCTTGATCGCCCCTAGGCCATGGGTGAAGAGCATTGAGGTCGCCAATGAGCCATCGACTTGGCTCGACGAG
AATGTGAATGAGGTGCCTCGACCATTAGTTGGTGTAGACATGATATGA
Gene >OphauG2|2157
ATGATCAAACTGAGCGATTCGCTGCTGCAGTTTGACGAGTATCCAGAGGAAGACGAGTATACGGCCATGGGCGGC
ATTCTGTGGGAGCAGGTCTATGGCTGGATTCGGTTGCCGAATAATTACGAGGCAATGACCACGGAGCAACTGAAA
AATGGAGAATCAAACTTTTACGACATGGCTCGTAAGCATCTTGCCTTCAATCGAGATTACAACAGCAACAAGTTC
AAGGGGCAGCCAGCTAGCGGGGGGCAACTACGACTAGCGGGGGCGCCACAATCAGAATGGCCATGGAGTTATTAC
CAAAATAAGCCTTTGCGGGAAGCAGCTTTGGAATTCATGCAGGAAATGGGCGGGGTTGTGGATTGGCATGGCGAT
TTCCCCTTGATCGCCCCTAGGCCATGGGTGAAGAGCATTGAGGTCGCCAATGAGCCATCGACTTGGCTCGACGAG
AATGTGAATGAGGTGCCTCGACCATTAGTTGGTGTAGACATGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail