Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2131
Gene name
LocationContig_172:20129..23980
Strand+
Gene length (bp)3851
Transcript length (bp)3783
Coding sequence length (bp)3783
Protein length (aa) 1261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13254 DUF4045 Domain of unknown function (DUF4045) 2.3E-19 141 217
PF13254 DUF4045 Domain of unknown function (DUF4045) 4.7E-25 218 312
PF13254 DUF4045 Domain of unknown function (DUF4045) 1.9E-39 356 455

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P14885|GELS_XENLA Gelsolin (Fragment) OS=Xenopus laevis GN=gsn PE=2 SV=1 909 1173 2.0E-13
sp|Q8WQ85|VILD_DICDI Villidin OS=Dictyostelium discoideum GN=vilA PE=1 SV=2 930 1230 7.0E-13
sp|O65570|VILI4_ARATH Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1 907 1241 2.0E-12
sp|P13020|GELS_MOUSE Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3 909 1226 7.0E-12
sp|P20305|GELS_PIG Gelsolin (Fragment) OS=Sus scrofa GN=GSN PE=1 SV=1 909 1226 2.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P14885|GELS_XENLA Gelsolin (Fragment) OS=Xenopus laevis GN=gsn PE=2 SV=1 909 1173 2.0E-13
sp|Q8WQ85|VILD_DICDI Villidin OS=Dictyostelium discoideum GN=vilA PE=1 SV=2 930 1230 7.0E-13
sp|O65570|VILI4_ARATH Villin-4 OS=Arabidopsis thaliana GN=VLN4 PE=1 SV=1 907 1241 2.0E-12
sp|P13020|GELS_MOUSE Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3 909 1226 7.0E-12
sp|P20305|GELS_PIG Gelsolin (Fragment) OS=Sus scrofa GN=GSN PE=1 SV=1 909 1226 2.0E-11
sp|Q27319|GELS_HOMAM Gelsolin, cytoplasmic OS=Homarus americanus PE=1 SV=1 921 1176 3.0E-11
sp|P06396|GELS_HUMAN Gelsolin OS=Homo sapiens GN=GSN PE=1 SV=1 909 1226 3.0E-11
sp|O93510|GELS_CHICK Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1 909 1226 4.0E-11
sp|Q3SX14|GELS_BOVIN Gelsolin OS=Bos taurus GN=GSN PE=2 SV=1 909 1226 5.0E-11
sp|Q62468|VILI_MOUSE Villin-1 OS=Mus musculus GN=Vil1 PE=1 SV=3 908 1176 5.0E-11
sp|O15195|VILL_HUMAN Villin-like protein OS=Homo sapiens GN=VILL PE=2 SV=3 911 1190 2.0E-10
sp|Q68FP1|GELS_RAT Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1 909 1226 3.0E-10
sp|O75366|AVIL_HUMAN Advillin OS=Homo sapiens GN=AVIL PE=1 SV=3 920 1232 3.0E-10
sp|Q29261|VILI_PIG Villin-1 OS=Sus scrofa GN=VIL1 PE=2 SV=2 920 1174 4.0E-10
sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 930 1241 5.0E-10
sp|Q28372|GELS_HORSE Gelsolin OS=Equus caballus GN=GSN PE=1 SV=2 909 1227 7.0E-10
sp|O81643|VILI1_ARATH Villin-1 OS=Arabidopsis thaliana GN=VLN1 PE=2 SV=2 907 1212 8.0E-10
sp|O81644|VILI2_ARATH Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2 913 1225 1.0E-09
sp|Q28046|ADSV_BOVIN Adseverin OS=Bos taurus GN=SCIN PE=1 SV=1 908 1174 1.0E-09
sp|O88398|AVIL_MOUSE Advillin OS=Mus musculus GN=Avil PE=1 SV=2 912 1192 2.0E-09
sp|Q3SZP7|VILI_BOVIN Villin-1 OS=Bos taurus GN=VIL1 PE=2 SV=3 920 1174 2.0E-09
sp|Q5ZIV9|ADSV_CHICK Adseverin OS=Gallus gallus GN=SCIN PE=2 SV=2 930 1189 3.0E-09
sp|P09327|VILI_HUMAN Villin-1 OS=Homo sapiens GN=VIL1 PE=1 SV=4 920 1190 9.0E-09
sp|Q5ZIV9|ADSV_CHICK Adseverin OS=Gallus gallus GN=SCIN PE=2 SV=2 908 1174 3.0E-08
sp|Q60604|ADSV_MOUSE Adseverin OS=Mus musculus GN=Scin PE=1 SV=3 934 1174 3.0E-08
sp|O61270|GELS_HALRO Gelsolin, cytoplasmic OS=Halocynthia roretzi PE=1 SV=1 908 1185 5.0E-08
sp|O81645|VILI3_ARATH Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2 930 1229 6.0E-08
sp|Q9Y6U3|ADSV_HUMAN Adseverin OS=Homo sapiens GN=SCIN PE=1 SV=4 908 1174 7.0E-08
sp|Q91YD6|VILL_MOUSE Villin-like protein OS=Mus musculus GN=Vill PE=1 SV=1 911 1173 7.0E-08
sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 930 1241 2.0E-07
sp|Q9WU06|AVIL_RAT Advillin OS=Rattus norvegicus GN=Avil PE=2 SV=1 920 1192 7.0E-07
sp|O81645|VILI3_ARATH Villin-3 OS=Arabidopsis thaliana GN=VLN3 PE=1 SV=2 920 1224 1.0E-06
sp|Q9LVC6|VILI5_ARATH Villin-5 OS=Arabidopsis thaliana GN=VLN5 PE=2 SV=1 907 1229 2.0E-06
sp|Q68FP1|GELS_RAT Gelsolin OS=Rattus norvegicus GN=Gsn PE=1 SV=1 930 1186 3.0E-06
sp|P02640|VILI_CHICK Villin-1 OS=Gallus gallus GN=VIL1 PE=1 SV=2 934 1190 3.0E-06
sp|P13020|GELS_MOUSE Gelsolin OS=Mus musculus GN=Gsn PE=1 SV=3 930 1186 1.0E-05
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2690
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2131 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5708
Ophiocordyceps camponoti-floridani Ophcf2|07052
Ophiocordyceps camponoti-rufipedis Ophun1|7248
Ophiocordyceps kimflemingae Ophio5|7826
Ophiocordyceps subramaniannii Hirsu2|4197

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2131
MALSSSPTKENEAPDAPQAGKRSSGTTRPARSSTLSWQRRPNSRPSSRPLSMVAAQNATNRPLDRPSESEEATTE
HTAQALGSKDPDTRPAPKPTLDNSPLHEVQTEHGHGPNMGSSIPQGLASQFDGAGDEKPDAPPAQPPSPTKGKGG
FVQSAMMKRSDSVKRWSVTSPPPLNRADSVAGSRTPVSATRPSSITTPTSSQPTGPPRDKEAKQDPAAKRDDDAS
LPTSPTKTMDSRRWSPTKSSWLESALNKPESPKSATKPSPSQPAWMVELNKAKAERAGNAAHKHQVSIGGLMRQS
PVGEVARPNTTGLGGIYSPPPNVTRPVKPSSLVGDKKTGSNDSEKAMGDDGTGGKTPQPVTSPPGVKLKGTAADS
PPKKDFRANLKPRSATQDSAKTDEPEFKNVFGNLRRTKTQNYVAPDELKANITRGKAALNVTDGPRKSERKDEFK
DAILKKRQDFEKKQAQGKGVVATKASSSAADKAVPEGLAKRAELDKAASGASTAASSRPASEAGDADIKSRPVST
EAEPRGPAPAKAVPQGRVGGGGIANKLADRFNPALAGMLARGPPLAAAGGNGESRSQPGSGAGGGLTEPGVPGPQ
LTHMTKGRARGPRRKAPSGSAATATTLSKAKTVDEAPAEAAKPTTLPQTPAEAAKPTTLPQTPAEAAKAKIAKEA
PAEAAKPTTLPKTPAETAVQQTAAAKSTLGNKPTLDTPGQVSAQQTKEPGSPGKKSRAPSPEKKTQEEASRPGKL
DAKRMSLFLDDAKAATHERTASQSPTKDGGDLVPSPTRSDRDGLPSMREAALRTSQPPSPTKFWSAPRSKSRPGS
SAGAGDGVGKPPRPGSVITGRSAAHASQTASPMASPSKSASDVSSLLTQFFGPPQPRKEARVDAADIVMTRPRSG
GRIDTISTQIVRMLGDGKKLPVSAQNERVLFEHDMYVCAHHYCGETGAKAFDLYFWVGDQVGDAAASDALVFVQR
EARALGGRLVRLQQGKETAEFVQALGGVMIVRRGSSNKYDSLAPNMLCGRRFLGQVVFDQVDFASSSLCSGFVYL
ITQAGTCFLWKGKGSDVAEVSCARLVGIDMALTGALVEYDEGSEPESFWRLFGDGAAACPQSADHWRLKPSYDRY
SSRLFVSDAHACQQIVEIAPFCQSDLVPDAIYIIDAFFEVYIIVGERANSQYASFRNALDFAQEYAILAAGMEDR
PFVPVSTVVLEGIPRDMKPVFRKWDDARSPTLTHQPQQGLRRGRSLRVLTLTQALQAVSD*
Coding >OphauG2|2131
ATGGCCCTGTCGAGCTCGCCGACAAAGGAAAACGAGGCACCGGATGCGCCACAGGCTGGCAAGCGCTCCAGCGGT
ACCACGCGGCCAGCCCGGTCTTCCACCTTGTCCTGGCAGCGGCGGCCCAACTCGCGCCCCAGCAGTCGCCCGCTG
AGCATGGTGGCGGCCCAGAACGCTACAAACAGGCCATTGGACCGGCCCAGCGAGTCAGAAGAGGCGACGACTGAA
CACACTGCGCAGGCCTTGGGCTCCAAGGACCCAGACACTCGTCCTGCGCCCAAGCCCACATTGGACAATTCGCCA
CTACACGAGGTGCAGACGGAGCATGGCCATGGACCCAACATGGGCTCGTCGATACCACAAGGCCTCGCATCCCAG
TTTGATGGCGCTGGCGATGAAAAGCCCGATGCCCCGCCAGCCCAGCCACCGTCGCCGACAAAGGGCAAGGGCGGC
TTTGTGCAGAGCGCAATGATGAAGCGAAGCGATAGCGTCAAGCGGTGGAGCGTCACCAGCCCCCCGCCATTGAAC
CGTGCCGACTCTGTGGCTGGCAGTCGCACGCCTGTGAGCGCGACGCGTCCATCAAGCATCACGACTCCCACCTCG
AGCCAGCCAACTGGACCACCGCGCGACAAGGAGGCCAAGCAGGACCCCGCGGCCAAGCGAGACGACGACGCCTCG
CTGCCCACCAGTCCCACCAAGACTATGGACTCGAGGCGCTGGAGCCCTACAAAGTCGAGCTGGCTGGAGAGCGCC
CTCAACAAGCCCGAATCGCCAAAGTCGGCCACAAAACCGAGCCCCTCGCAACCGGCGTGGATGGTTGAGCTGAAC
AAGGCCAAGGCTGAGCGCGCGGGAAATGCCGCCCACAAGCACCAGGTCAGCATTGGCGGGCTCATGAGGCAGTCG
CCGGTGGGAGAGGTGGCTCGGCCAAACACGACGGGCTTGGGAGGCATATACTCGCCGCCACCAAACGTCACGCGG
CCTGTCAAGCCAAGCAGCCTGGTGGGAGACAAGAAGACGGGCAGTAATGATTCAGAAAAGGCCATGGGTGATGAC
GGCACAGGTGGCAAAACACCACAGCCAGTTACAAGCCCGCCGGGCGTCAAGCTCAAGGGCACCGCTGCCGACAGT
CCGCCAAAGAAGGACTTTAGAGCCAACCTGAAGCCTCGGTCAGCCACACAAGACTCGGCCAAGACGGACGAGCCA
GAGTTCAAAAACGTGTTTGGCAATCTGCGGCGGACCAAGACGCAAAACTACGTGGCACCCGATGAGCTCAAGGCC
AACATTACGCGCGGCAAGGCAGCGCTTAATGTGACGGATGGGCCGCGCAAGAGCGAGCGCAAAGATGAATTCAAG
GACGCCATTCTCAAGAAGCGCCAAGACTTTGAGAAGAAGCAGGCCCAAGGCAAGGGCGTCGTCGCCACCAAGGCG
TCCTCGTCTGCAGCGGACAAGGCGGTCCCCGAGGGCCTGGCCAAGAGGGCTGAACTCGACAAGGCTGCCTCTGGC
GCAAGCACTGCAGCGTCGTCGAGGCCAGCCTCGGAGGCGGGCGATGCGGACATCAAGTCTCGGCCTGTGTCTACA
GAGGCGGAGCCGCGTGGTCCTGCTCCCGCCAAGGCGGTGCCCCAGGGCCGAGTAGGAGGAGGGGGCATCGCAAAC
AAGCTGGCAGATCGCTTCAACCCGGCGCTGGCAGGGATGCTGGCCAGAGGCCCTCCTCTGGCGGCGGCCGGGGGC
AATGGTGAATCTCGGTCGCAGCCAGGCTCGGGTGCTGGTGGTGGCTTGACTGAGCCTGGCGTGCCGGGGCCGCAG
CTGACGCACATGACCAAAGGCAGAGCTCGAGGACCTAGAAGGAAGGCTCCGTCTGGTTCAGCAGCGACAGCCACG
ACTTTGAGCAAGGCCAAGACTGTGGACGAAGCGCCAGCAGAGGCAGCAAAGCCTACTACTTTGCCGCAGACACCA
GCAGAGGCAGCAAAGCCTACTACTTTGCCACAGACACCAGCAGAGGCAGCCAAGGCCAAGATTGCGAAAGAAGCG
CCAGCAGAGGCAGCAAAGCCTACTACGTTGCCAAAGACGCCAGCAGAGACGGCGGTGCAACAGACAGCAGCTGCA
AAGTCGACTCTTGGCAACAAGCCAACCTTGGACACGCCAGGTCAAGTCTCGGCTCAGCAGACCAAGGAGCCTGGC
AGCCCTGGCAAGAAGTCGCGTGCGCCGTCCCCGGAAAAAAAGACCCAGGAGGAAGCTTCACGACCTGGCAAGCTC
GACGCGAAACGCATGTCGCTATTTCTCGACGACGCCAAAGCAGCGACGCATGAGCGCACGGCATCTCAGTCTCCC
ACCAAGGATGGCGGCGACTTGGTGCCATCACCAACAAGGAGCGATCGTGACGGGCTGCCTTCAATGAGAGAGGCG
GCGCTGCGGACGTCGCAGCCACCGTCTCCAACCAAGTTTTGGTCGGCACCGCGGTCCAAGTCTCGGCCGGGGTCC
AGTGCGGGTGCTGGCGATGGCGTCGGCAAGCCTCCTCGGCCAGGGTCCGTCATTACCGGCCGCTCAGCGGCACAC
GCATCGCAAACCGCCTCGCCCATGGCATCGCCGTCCAAGAGCGCCAGCGACGTGTCGTCTTTGCTGACGCAGTTC
TTTGGCCCGCCACAGCCGCGCAAAGAGGCGCGTGTCGACGCCGCCGACATTGTCATGACGCGGCCCCGCAGCGGC
GGGCGCATCGACACCATCAGCACGCAAATCGTGCGCATGCTGGGCGACGGCAAGAAGCTGCCCGTGTCGGCGCAG
AACGAGCGGGTGCTGTTTGAGCACGACATGTACGTGTGCGCCCACCACTACTGCGGCGAGACGGGAGCCAAGGCC
TTTGATCTCTACTTCTGGGTCGGCGACCAAGTTGGCGACGCGGCCGCTTCCGACGCGCTCGTCTTTGTGCAGCGC
GAGGCCCGCGCCCTGGGCGGCCGACTGGTGCGCCTGCAGCAGGGCAAGGAGACGGCCGAGTTTGTCCAGGCGCTG
GGCGGCGTCATGATTGTGCGCCGCGGCTCGAGCAACAAGTACGACTCGCTGGCGCCCAACATGCTGTGTGGCCGC
CGCTTCCTCGGCCAGGTGGTCTTTGACCAGGTCGACTTTGCCTCGTCGAGCCTGTGCTCGGGCTTTGTCTACCTC
ATCACCCAGGCCGGCACGTGTTTCCTGTGGAAGGGCAAGGGCAGCGACGTGGCCGAGGTGAGCTGTGCGCGCCTC
GTCGGCATCGACATGGCCTTGACGGGCGCGCTGGTTGAGTACGACGAGGGCAGCGAGCCCGAGTCGTTCTGGCGC
CTCTTTGGCGACGGGGCCGCCGCCTGTCCACAGTCGGCCGACCACTGGAGGCTCAAGCCGAGCTATGATAGGTAT
AGCAGCCGGCTCTTTGTCTCGGATGCTCACGCCTGCCAGCAGATTGTCGAAATCGCCCCCTTTTGCCAGTCGGAT
CTCGTCCCCGATGCCATCTACATCATCGACGCCTTCTTCGAAGTCTACATCATTGTCGGCGAGCGCGCAAACTCG
CAGTATGCCTCGTTTCGCAACGCTCTCGACTTTGCCCAAGAATACGCCATCTTGGCCGCCGGCATGGAGGACCGC
CCCTTTGTCCCCGTGTCCACGGTTGTCCTTGAGGGCATCCCCCGCGACATGAAGCCCGTCTTTCGCAAGTGGGAC
GACGCCCGCAGCCCAACCCTTACCCATCAGCCCCAGCAGGGCCTGAGGCGGGGCCGCAGCTTAAGGGTCTTGACT
CTGACACAGGCGCTGCAGGCTGTCAGCGACTAA
Transcript >OphauG2|2131
ATGGCCCTGTCGAGCTCGCCGACAAAGGAAAACGAGGCACCGGATGCGCCACAGGCTGGCAAGCGCTCCAGCGGT
ACCACGCGGCCAGCCCGGTCTTCCACCTTGTCCTGGCAGCGGCGGCCCAACTCGCGCCCCAGCAGTCGCCCGCTG
AGCATGGTGGCGGCCCAGAACGCTACAAACAGGCCATTGGACCGGCCCAGCGAGTCAGAAGAGGCGACGACTGAA
CACACTGCGCAGGCCTTGGGCTCCAAGGACCCAGACACTCGTCCTGCGCCCAAGCCCACATTGGACAATTCGCCA
CTACACGAGGTGCAGACGGAGCATGGCCATGGACCCAACATGGGCTCGTCGATACCACAAGGCCTCGCATCCCAG
TTTGATGGCGCTGGCGATGAAAAGCCCGATGCCCCGCCAGCCCAGCCACCGTCGCCGACAAAGGGCAAGGGCGGC
TTTGTGCAGAGCGCAATGATGAAGCGAAGCGATAGCGTCAAGCGGTGGAGCGTCACCAGCCCCCCGCCATTGAAC
CGTGCCGACTCTGTGGCTGGCAGTCGCACGCCTGTGAGCGCGACGCGTCCATCAAGCATCACGACTCCCACCTCG
AGCCAGCCAACTGGACCACCGCGCGACAAGGAGGCCAAGCAGGACCCCGCGGCCAAGCGAGACGACGACGCCTCG
CTGCCCACCAGTCCCACCAAGACTATGGACTCGAGGCGCTGGAGCCCTACAAAGTCGAGCTGGCTGGAGAGCGCC
CTCAACAAGCCCGAATCGCCAAAGTCGGCCACAAAACCGAGCCCCTCGCAACCGGCGTGGATGGTTGAGCTGAAC
AAGGCCAAGGCTGAGCGCGCGGGAAATGCCGCCCACAAGCACCAGGTCAGCATTGGCGGGCTCATGAGGCAGTCG
CCGGTGGGAGAGGTGGCTCGGCCAAACACGACGGGCTTGGGAGGCATATACTCGCCGCCACCAAACGTCACGCGG
CCTGTCAAGCCAAGCAGCCTGGTGGGAGACAAGAAGACGGGCAGTAATGATTCAGAAAAGGCCATGGGTGATGAC
GGCACAGGTGGCAAAACACCACAGCCAGTTACAAGCCCGCCGGGCGTCAAGCTCAAGGGCACCGCTGCCGACAGT
CCGCCAAAGAAGGACTTTAGAGCCAACCTGAAGCCTCGGTCAGCCACACAAGACTCGGCCAAGACGGACGAGCCA
GAGTTCAAAAACGTGTTTGGCAATCTGCGGCGGACCAAGACGCAAAACTACGTGGCACCCGATGAGCTCAAGGCC
AACATTACGCGCGGCAAGGCAGCGCTTAATGTGACGGATGGGCCGCGCAAGAGCGAGCGCAAAGATGAATTCAAG
GACGCCATTCTCAAGAAGCGCCAAGACTTTGAGAAGAAGCAGGCCCAAGGCAAGGGCGTCGTCGCCACCAAGGCG
TCCTCGTCTGCAGCGGACAAGGCGGTCCCCGAGGGCCTGGCCAAGAGGGCTGAACTCGACAAGGCTGCCTCTGGC
GCAAGCACTGCAGCGTCGTCGAGGCCAGCCTCGGAGGCGGGCGATGCGGACATCAAGTCTCGGCCTGTGTCTACA
GAGGCGGAGCCGCGTGGTCCTGCTCCCGCCAAGGCGGTGCCCCAGGGCCGAGTAGGAGGAGGGGGCATCGCAAAC
AAGCTGGCAGATCGCTTCAACCCGGCGCTGGCAGGGATGCTGGCCAGAGGCCCTCCTCTGGCGGCGGCCGGGGGC
AATGGTGAATCTCGGTCGCAGCCAGGCTCGGGTGCTGGTGGTGGCTTGACTGAGCCTGGCGTGCCGGGGCCGCAG
CTGACGCACATGACCAAAGGCAGAGCTCGAGGACCTAGAAGGAAGGCTCCGTCTGGTTCAGCAGCGACAGCCACG
ACTTTGAGCAAGGCCAAGACTGTGGACGAAGCGCCAGCAGAGGCAGCAAAGCCTACTACTTTGCCGCAGACACCA
GCAGAGGCAGCAAAGCCTACTACTTTGCCACAGACACCAGCAGAGGCAGCCAAGGCCAAGATTGCGAAAGAAGCG
CCAGCAGAGGCAGCAAAGCCTACTACGTTGCCAAAGACGCCAGCAGAGACGGCGGTGCAACAGACAGCAGCTGCA
AAGTCGACTCTTGGCAACAAGCCAACCTTGGACACGCCAGGTCAAGTCTCGGCTCAGCAGACCAAGGAGCCTGGC
AGCCCTGGCAAGAAGTCGCGTGCGCCGTCCCCGGAAAAAAAGACCCAGGAGGAAGCTTCACGACCTGGCAAGCTC
GACGCGAAACGCATGTCGCTATTTCTCGACGACGCCAAAGCAGCGACGCATGAGCGCACGGCATCTCAGTCTCCC
ACCAAGGATGGCGGCGACTTGGTGCCATCACCAACAAGGAGCGATCGTGACGGGCTGCCTTCAATGAGAGAGGCG
GCGCTGCGGACGTCGCAGCCACCGTCTCCAACCAAGTTTTGGTCGGCACCGCGGTCCAAGTCTCGGCCGGGGTCC
AGTGCGGGTGCTGGCGATGGCGTCGGCAAGCCTCCTCGGCCAGGGTCCGTCATTACCGGCCGCTCAGCGGCACAC
GCATCGCAAACCGCCTCGCCCATGGCATCGCCGTCCAAGAGCGCCAGCGACGTGTCGTCTTTGCTGACGCAGTTC
TTTGGCCCGCCACAGCCGCGCAAAGAGGCGCGTGTCGACGCCGCCGACATTGTCATGACGCGGCCCCGCAGCGGC
GGGCGCATCGACACCATCAGCACGCAAATCGTGCGCATGCTGGGCGACGGCAAGAAGCTGCCCGTGTCGGCGCAG
AACGAGCGGGTGCTGTTTGAGCACGACATGTACGTGTGCGCCCACCACTACTGCGGCGAGACGGGAGCCAAGGCC
TTTGATCTCTACTTCTGGGTCGGCGACCAAGTTGGCGACGCGGCCGCTTCCGACGCGCTCGTCTTTGTGCAGCGC
GAGGCCCGCGCCCTGGGCGGCCGACTGGTGCGCCTGCAGCAGGGCAAGGAGACGGCCGAGTTTGTCCAGGCGCTG
GGCGGCGTCATGATTGTGCGCCGCGGCTCGAGCAACAAGTACGACTCGCTGGCGCCCAACATGCTGTGTGGCCGC
CGCTTCCTCGGCCAGGTGGTCTTTGACCAGGTCGACTTTGCCTCGTCGAGCCTGTGCTCGGGCTTTGTCTACCTC
ATCACCCAGGCCGGCACGTGTTTCCTGTGGAAGGGCAAGGGCAGCGACGTGGCCGAGGTGAGCTGTGCGCGCCTC
GTCGGCATCGACATGGCCTTGACGGGCGCGCTGGTTGAGTACGACGAGGGCAGCGAGCCCGAGTCGTTCTGGCGC
CTCTTTGGCGACGGGGCCGCCGCCTGTCCACAGTCGGCCGACCACTGGAGGCTCAAGCCGAGCTATGATAGGTAT
AGCAGCCGGCTCTTTGTCTCGGATGCTCACGCCTGCCAGCAGATTGTCGAAATCGCCCCCTTTTGCCAGTCGGAT
CTCGTCCCCGATGCCATCTACATCATCGACGCCTTCTTCGAAGTCTACATCATTGTCGGCGAGCGCGCAAACTCG
CAGTATGCCTCGTTTCGCAACGCTCTCGACTTTGCCCAAGAATACGCCATCTTGGCCGCCGGCATGGAGGACCGC
CCCTTTGTCCCCGTGTCCACGGTTGTCCTTGAGGGCATCCCCCGCGACATGAAGCCCGTCTTTCGCAAGTGGGAC
GACGCCCGCAGCCCAACCCTTACCCATCAGCCCCAGCAGGGCCTGAGGCGGGGCCGCAGCTTAAGGGTCTTGACT
CTGACACAGGCGCTGCAGGCTGTCAGCGACTAA
Gene >OphauG2|2131
ATGGCCCTGTCGAGCTCGCCGACAAAGGAAAACGAGGCACCGGATGCGCCACAGGCTGGCAAGCGCTCCAGCGGT
ACCACGCGGCCAGCCCGGTCTTCCACCTTGTCCTGGCAGCGGCGGCCCAACTCGCGCCCCAGCAGTCGCCCGCTG
AGCATGGTGGCGGCCCAGAACGCTACAAACAGGCCATTGGACCGGCCCAGCGAGTCAGAAGAGGCGACGACTGAA
CACACTGCGCAGGCCTTGGGCTCCAAGGACCCAGACACTCGTCCTGCGCCCAAGCCCACATTGGACAATTCGCCA
CTACACGAGGTGCAGACGGAGCATGGCCATGGACCCAACATGGGCTCGTCGATACCACAAGGCCTCGCATCCCAG
TTTGATGGCGCTGGCGATGAAAAGCCCGATGCCCCGCCAGCCCAGCCACCGTCGCCGACAAAGGGCAAGGGCGGC
TTTGTGCAGAGCGCAATGATGAAGCGAAGCGATAGCGTCAAGCGGTGGAGCGTCACCAGCCCCCCGCCATTGAAC
CGTGCCGACTCTGTGGCTGGCAGTCGCACGCCTGTGAGCGCGACGCGTCCATCAAGCATCACGACTCCCACCTCG
AGCCAGCCAACTGGACCACCGCGCGACAAGGAGGCCAAGCAGGACCCCGCGGCCAAGCGAGACGACGACGCCTCG
CTGCCCACCAGTCCCACCAAGACTATGGACTCGAGGCGCTGGAGCCCTACAAAGTCGAGCTGGCTGGAGAGCGCC
CTCAACAAGCCCGAATCGCCAAAGTCGGCCACAAAACCGAGCCCCTCGCAACCGGCGTGGATGGTTGAGCTGAAC
AAGGCCAAGGCTGAGCGCGCGGGAAATGCCGCCCACAAGCACCAGGTCAGCATTGGCGGGCTCATGAGGCAGTCG
CCGGTGGGAGAGGTGGCTCGGCCAAACACGACGGGCTTGGGAGGCATATACTCGCCGCCACCAAACGTCACGCGG
CCTGTCAAGCCAAGCAGCCTGGTGGGAGACAAGAAGACGGGCAGTAATGATTCAGAAAAGGCCATGGGTGATGAC
GGCACAGGTGGCAAAACACCACAGCCAGTTACAAGCCCGCCGGGCGTCAAGCTCAAGGGCACCGCTGCCGACAGT
CCGCCAAAGAAGGACTTTAGAGCCAACCTGAAGCCTCGGTCAGCCACACAAGACTCGGCCAAGACGGACGAGCCA
GAGTTCAAAAACGTGTTTGGCAATCTGCGGCGGACCAAGACGCAAAACTACGTGGCACCCGATGAGCTCAAGGCC
AACATTACGCGCGGCAAGGCAGCGCTTAATGTGACGGATGGGCCGCGCAAGAGCGAGCGCAAAGATGAATTCAAG
GACGCCATTCTCAAGAAGCGCCAAGACTTTGAGAAGAAGCAGGCCCAAGGCAAGGGCGTCGTCGCCACCAAGGCG
TCCTCGTCTGCAGCGGACAAGGCGGTCCCCGAGGGCCTGGCCAAGAGGGCTGAACTCGACAAGGCTGCCTCTGGC
GCAAGCACTGCAGCGTCGTCGAGGCCAGCCTCGGAGGCGGGCGATGCGGACATCAAGTCTCGGCCTGTGTCTACA
GAGGCGGAGCCGCGTGGTCCTGCTCCCGCCAAGGCGGTGCCCCAGGGCCGAGTAGGAGGAGGGGGCATCGCAAAC
AAGCTGGCAGATCGCTTCAACCCGGCGCTGGCAGGGATGCTGGCCAGAGGCCCTCCTCTGGCGGCGGCCGGGGGC
AATGGTGAATCTCGGTCGCAGCCAGGCTCGGGTGCTGGTGGTGGCTTGACTGAGCCTGGCGTGCCGGGGCCGCAG
CTGACGCACATGACCAAAGGCAGAGCTCGAGGACCTAGAAGGAAGGCTCCGTCTGGTTCAGCAGCGACAGCCACG
ACTTTGAGCAAGGCCAAGACTGTGGACGAAGCGCCAGCAGAGGCAGCAAAGCCTACTACTTTGCCGCAGACACCA
GCAGAGGCAGCAAAGCCTACTACTTTGCCACAGACACCAGCAGAGGCAGCCAAGGCCAAGATTGCGAAAGAAGCG
CCAGCAGAGGCAGCAAAGCCTACTACGTTGCCAAAGACGCCAGCAGAGACGGCGGTGCAACAGACAGCAGCTGCA
AAGTCGACTCTTGGCAACAAGCCAACCTTGGACACGCCAGGTCAAGTCTCGGCTCAGCAGACCAAGGAGCCTGGC
AGCCCTGGCAAGAAGTCGCGTGCGCCGTCCCCGGAAAAAAAGACCCAGGAGGAAGCTTCACGACCTGGCAAGCTC
GACGCGAAACGCATGTCGCTATTTCTCGACGACGCCAAAGCAGCGACGCATGAGCGCACGGCATCTCAGTCTCCC
ACCAAGGATGGCGGCGACTTGGTGCCATCACCAACAAGGAGCGATCGTGACGGGCTGCCTTCAATGAGAGAGGCG
GCGCTGCGGACGTCGCAGCCACCGTCTCCAACCAAGTTTTGGTCGGCACCGCGGTCCAAGTCTCGGCCGGGGTCC
AGTGCGGGTGCTGGCGATGGCGTCGGCAAGCCTCCTCGGCCAGGGTCCGTCATTACCGGCCGCTCAGCGGCACAC
GCATCGCAAACCGCCTCGCCCATGGCATCGCCGTCCAAGAGCGCCAGCGACGTGTCGTCTTTGCTGACGCAGTTC
TTTGGCCCGCCACAGCCGCGCAAAGAGGCGCGTGTCGACGCCGCCGACATTGTCATGACGCGGCCCCGCAGCGGC
GGGCGCATCGACACCATCAGCACGCAAATCGTGCGCATGCTGGGCGACGGCAAGAAGCTGCCCGTGTCGGCGCAG
AACGAGCGGGTGCTGTTTGAGCACGACATGTACGTGTGCGCCCACCACTACTGCGGCGAGACGGGAGCCAAGGCC
TTTGATCTCTACTTCTGGGTCGGCGACCAAGTTGGCGACGCGGCCGCTTCCGACGCGCTCGTCTTTGTGCAGCGC
GAGGCCCGCGCCCTGGGCGGCCGACTGGTGCGCCTGCAGCAGGGCAAGGAGACGGCCGAGTTTGTCCAGGCGCTG
GGCGGCGTCATGATTGTGCGCCGCGGCTCGAGCAACAAGTACGACTCGCTGGCGCCCAACATGCTGTGTGGCCGC
CGCTTCCTCGGCCAGGTGGTCTTTGACCAGGTCGACTTTGCCTCGTCGAGCCTGTGCTCGGGCTTTGTCTACCTC
ATCACCCAGGCCGGCACGTGTTTCCTGTGGAAGGGCAAGGGCAGCGACGTGGCCGAGGTGAGCTGTGCGCGCCTC
GTCGGCATCGACATGGCCTTGACGGGCGCGCTGGTTGAGTACGACGAGGGCAGCGAGCCCGAGTCGTTCTGGCGC
CTCTTTGGCGACGGGGCCGCCGCCTGTCCACAGTCGGCCGACCACTGGAGGCTCAAGCCGAGCTATGATAGGTAT
AGCAGCCGGCTCTTTGTCTCGGATGCTCACGCCTGCCAGCAGGTCAGTCTTGCCCCATGTTGCCATCTCTTTTCT
CTTGTCCATGTTCCCCCGGCACTGACGCCTTGTAGATTGTCGAAATCGCCCCCTTTTGCCAGTCGGATCTCGTCC
CCGATGCCATCTACATCATCGACGCCTTCTTCGAAGTCTACATCATTGTCGGCGAGCGCGCAAACTCGCAGTATG
CCTCGTTTCGCAACGCTCTCGACTTTGCCCAAGAATACGCCATCTTGGCCGCCGGCATGGAGGACCGCCCCTTTG
TCCCCGTGTCCACGGTTGTCCTTGAGGGCATCCCCCGCGACATGAAGCCCGTCTTTCGCAAGTGGGACGACGCCC
GCAGCCCAACCCTTACCCATCAGCCCCAGCAGGGCCTGAGGCGGGGCCGCAGCTTAAGGGTCTTGACTCTGACAC
AGGCGCTGCAGGCTGTCAGCGACTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail