Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2124
Gene name
LocationContig_1717:2077..2460
Strand-
Gene length (bp)383
Transcript length (bp)309
Coding sequence length (bp)309
Protein length (aa) 103

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 5.9E-16 7 72

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 9 79 2.0E-20
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 9 80 3.0E-12
sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 8 84 7.0E-09
sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 8 84 9.0E-09
sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 8 84 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 9 79 2.0E-20
sp|P38922|HRB1_YEAST Protein HRB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HRB1 PE=1 SV=2 9 80 3.0E-12
sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 8 84 7.0E-09
sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 8 84 9.0E-09
sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 8 84 1.0E-08
sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 9 84 1.0E-08
sp|P25555|GBP2_YEAST Single-strand telomeric DNA-binding protein GBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GBP2 PE=1 SV=1 9 78 1.0E-08
sp|Q9P2K5|MYEF2_HUMAN Myelin expression factor 2 OS=Homo sapiens GN=MYEF2 PE=1 SV=3 7 74 1.0E-08
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 9 75 2.0E-08
sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 9 77 2.0E-08
sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 9 77 3.0E-08
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 9 75 6.0E-08
sp|Q9JJW6|ALRF2_MOUSE Aly/REF export factor 2 OS=Mus musculus GN=Alyref2 PE=1 SV=1 9 77 9.0E-08
sp|Q6GLW1|THO4B_XENLA THO complex subunit 4-B OS=Xenopus laevis GN=alyref-b PE=2 SV=1 9 77 2.0E-07
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 8 77 3.0E-07
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 8 75 3.0E-07
sp|Q8L719|THO4B_ARATH THO complex subunit 4B OS=Arabidopsis thaliana GN=ALY2 PE=1 SV=1 9 77 6.0E-07
sp|Q8C854|MYEF2_MOUSE Myelin expression factor 2 OS=Mus musculus GN=Myef2 PE=1 SV=1 7 74 8.0E-07
sp|Q8L773|THO4A_ARATH THO complex subunit 4A OS=Arabidopsis thaliana GN=ALY1 PE=1 SV=1 9 77 1.0E-06
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 9 84 1.0E-06
sp|Q6NQ72|THO4D_ARATH THO complex subunit 4D OS=Arabidopsis thaliana GN=ALY4 PE=1 SV=1 9 89 2.0E-06
sp|Q9FXA2|PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana GN=PAB8 PE=1 SV=1 7 78 2.0E-06
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 9 75 2.0E-06
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 9 75 3.0E-06
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 8 75 3.0E-06
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 9 75 3.0E-06
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 9 86 4.0E-06
sp|P42731|PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PAB2 PE=1 SV=1 7 78 4.0E-06
sp|O64380|PABP3_ARATH Polyadenylate-binding protein 3 OS=Arabidopsis thaliana GN=PAB3 PE=2 SV=1 7 78 8.0E-06
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 8 75 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2124
MPLLAPRGLPWSTSNDDLVELFTTIGKVEQAEIQYEPSGRSRGTGVVRFDSPETAETAIAKFQGYQYGGRPLNLS
FVKYLNRGGSDTMETDAHAGLTQDQIM*
Coding >OphauG2|2124
ATGCCACTGCTGGCACCGAGAGGACTACCCTGGTCCACGAGTAACGATGATCTCGTTGAACTCTTCACCACCATC
GGTAAGGTGGAGCAGGCAGAGATCCAGTATGAACCAAGCGGTCGCTCTCGGGGCACCGGTGTCGTACGCTTTGAC
TCCCCAGAAACTGCCGAGACTGCCATTGCAAAATTTCAAGGCTATCAGTATGGGGGCCGTCCTCTAAACTTGAGC
TTTGTCAAGTATCTCAACCGGGGCGGGAGCGACACAATGGAGACGGACGCCCACGCAGGCCTGACCCAGGATCAG
ATTATGTGA
Transcript >OphauG2|2124
ATGCCACTGCTGGCACCGAGAGGACTACCCTGGTCCACGAGTAACGATGATCTCGTTGAACTCTTCACCACCATC
GGTAAGGTGGAGCAGGCAGAGATCCAGTATGAACCAAGCGGTCGCTCTCGGGGCACCGGTGTCGTACGCTTTGAC
TCCCCAGAAACTGCCGAGACTGCCATTGCAAAATTTCAAGGCTATCAGTATGGGGGCCGTCCTCTAAACTTGAGC
TTTGTCAAGTATCTCAACCGGGGCGGGAGCGACACAATGGAGACGGACGCCCACGCAGGCCTGACCCAGGATCAG
ATTATGTGA
Gene >OphauG2|2124
ATGCCACTGCTGGCACCGAGAGGAGTGAAATCATATTTGTTCGAAACGTGAGTCCACTCAGGCCGTATTCTTCAG
CTCTCGTTTTAACGTCCTGTCAGCTACCCTGGTCCACGAGTAACGATGATCTCGTTGAACTCTTCACCACCATCG
GTAAGGTGGAGCAGGCAGAGATCCAGTATGAACCAAGCGGTCGCTCTCGGGGCACCGGTGTCGTACGCTTTGACT
CCCCAGAAACTGCCGAGACTGCCATTGCAAAATTTCAAGGCTATCAGTATGGGGGCCGTCCTCTAAACTTGAGCT
TTGTCAAGTATCTCAACCGGGGCGGGAGCGACACAATGGAGACGGACGCCCACGCAGGCCTGACCCAGGATCAGA
TTATGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail