Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|212
Gene name
LocationContig_104:27175..28043
Strand-
Gene length (bp)868
Transcript length (bp)795
Coding sequence length (bp)795
Protein length (aa) 265

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC) 4.1E-07 59 178

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B5D4|SOD5_ARTBC Cell surface Cu-only superoxide dismutase ARB_03674 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03674 PE=1 SV=1 5 241 6.0E-38
sp|Q5ACV9|SOD6_CANAL Cell surface superoxide dismutase [Cu-Zn] 6 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD6 PE=1 SV=1 59 193 3.0E-23
sp|Q5AD05|SOD4_CANAL Cell surface superoxide dismutase [Cu-Zn] 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD4 PE=1 SV=1 58 196 3.0E-23
sp|Q5AD07|SOD5_CANAL Cell surface Cu-only superoxide dismutase 5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SOD5 PE=1 SV=1 58 193 3.0E-22

GO

GO Term Description Terminal node
GO:0006801 superoxide metabolic process Yes
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0072593 reactive oxygen species metabolic process No
GO:0008152 metabolic process No
GO:0043169 cation binding No
GO:0044237 cellular metabolic process No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0008150 biological_process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|212
MMMPSAPVLAAMCLAGSAVAQIGSFPEAMPATGNPTGVTYKAVLPQEPFFTEGPLNGNVRGSIEATAPEDGVGVQ
FTVKFDNVPTSGGGPFTYHIHVDAVPADGNCTKALTHLDPLNRGETPVCDSSAPSTCQVGDLAGKHGKVTSGPFN
VQYVDPYVSLREGDAAFMGNRSFVFHFANKTRITCANFYRVDDEDEDGAPSYLPQPTTFPNLPGSNSSQPGVYPT
GSSGIGRPSGLPLVSAAATRHLSSAFTVAVAAIALAFLH*
Coding >OphauG2|212
ATGATGATGCCTAGCGCCCCCGTTTTAGCGGCCATGTGCCTGGCTGGCTCGGCTGTAGCCCAGATCGGTTCGTTC
CCAGAGGCGATGCCTGCTACCGGCAACCCGACGGGCGTCACATACAAAGCGGTTCTTCCTCAAGAGCCCTTCTTC
ACCGAGGGTCCTCTCAACGGCAACGTACGGGGATCCATCGAGGCCACGGCGCCAGAAGACGGCGTGGGTGTTCAG
TTCACCGTCAAGTTTGACAACGTGCCCACCTCTGGCGGCGGCCCCTTTACCTACCACATCCACGTCGACGCCGTG
CCGGCTGATGGCAACTGTACCAAGGCCTTGACGCATTTGGATCCACTCAACCGCGGCGAGACGCCAGTGTGCGAC
TCGTCGGCGCCATCCACCTGCCAAGTGGGCGACTTGGCGGGCAAACACGGCAAAGTCACGTCTGGGCCCTTCAAC
GTGCAGTACGTCGACCCGTACGTGTCGCTGCGCGAAGGCGACGCCGCCTTTATGGGCAACCGTTCCTTTGTCTTT
CACTTTGCCAACAAGACACGCATCACGTGCGCAAACTTTTACCGCGTCGATGACGAAGACGAAGACGGCGCCCCG
AGCTACTTGCCACAGCCCACGACATTCCCCAACCTGCCTGGAAGCAACTCGTCGCAGCCGGGCGTCTATCCCACC
GGATCTTCGGGCATTGGCCGCCCAAGTGGCCTGCCGCTCGTGAGTGCTGCTGCGACGCGGCATCTGTCTTCAGCC
TTTACTGTTGCAGTGGCAGCCATTGCGCTTGCGTTTTTGCACTAA
Transcript >OphauG2|212
ATGATGATGCCTAGCGCCCCCGTTTTAGCGGCCATGTGCCTGGCTGGCTCGGCTGTAGCCCAGATCGGTTCGTTC
CCAGAGGCGATGCCTGCTACCGGCAACCCGACGGGCGTCACATACAAAGCGGTTCTTCCTCAAGAGCCCTTCTTC
ACCGAGGGTCCTCTCAACGGCAACGTACGGGGATCCATCGAGGCCACGGCGCCAGAAGACGGCGTGGGTGTTCAG
TTCACCGTCAAGTTTGACAACGTGCCCACCTCTGGCGGCGGCCCCTTTACCTACCACATCCACGTCGACGCCGTG
CCGGCTGATGGCAACTGTACCAAGGCCTTGACGCATTTGGATCCACTCAACCGCGGCGAGACGCCAGTGTGCGAC
TCGTCGGCGCCATCCACCTGCCAAGTGGGCGACTTGGCGGGCAAACACGGCAAAGTCACGTCTGGGCCCTTCAAC
GTGCAGTACGTCGACCCGTACGTGTCGCTGCGCGAAGGCGACGCCGCCTTTATGGGCAACCGTTCCTTTGTCTTT
CACTTTGCCAACAAGACACGCATCACGTGCGCAAACTTTTACCGCGTCGATGACGAAGACGAAGACGGCGCCCCG
AGCTACTTGCCACAGCCCACGACATTCCCCAACCTGCCTGGAAGCAACTCGTCGCAGCCGGGCGTCTATCCCACC
GGATCTTCGGGCATTGGCCGCCCAAGTGGCCTGCCGCTCGTGAGTGCTGCTGCGACGCGGCATCTGTCTTCAGCC
TTTACTGTTGCAGTGGCAGCCATTGCGCTTGCGTTTTTGCACTAA
Gene >OphauG2|212
ATGATGATGCCTAGCGCCCCCGTTTTAGCGGCCATGTGCCTGGCTGGCTCGGCTGTAGCCCAGATCGGTTCGTTC
CCAGAGGCGATGCCTGCTACCGGCAACCCGACGGGCGTCACATACAAAGCGGTTCTTCCTCAAGAGCCCTTCTTC
ACCGAGGGTCCTCTCAACGGCAACGTACGGGGATCCATCGAGGCCACGGCGCCAGAAGACGGCGTGGGTGTTCAG
TTCACCGTCAAGTTTGACAACGTGCCCACCTCTGGCGGCGGCCCCTTTAGTGAGTAGCTTTCCGGGAAAAAAAAA
AAAAAAAGAAACAGCCTGGTCAGACTAACGCTTTTGTCTCTCTCCAGCCTACCACATCCACGTCGACGCCGTGCC
GGCTGATGGCAACTGTACCAAGGCCTTGACGCATTTGGATCCACTCAACCGCGGCGAGACGCCAGTGTGCGACTC
GTCGGCGCCATCCACCTGCCAAGTGGGCGACTTGGCGGGCAAACACGGCAAAGTCACGTCTGGGCCCTTCAACGT
GCAGTACGTCGACCCGTACGTGTCGCTGCGCGAAGGCGACGCCGCCTTTATGGGCAACCGTTCCTTTGTCTTTCA
CTTTGCCAACAAGACACGCATCACGTGCGCAAACTTTTACCGCGTCGATGACGAAGACGAAGACGGCGCCCCGAG
CTACTTGCCACAGCCCACGACATTCCCCAACCTGCCTGGAAGCAACTCGTCGCAGCCGGGCGTCTATCCCACCGG
ATCTTCGGGCATTGGCCGCCCAAGTGGCCTGCCGCTCGTGAGTGCTGCTGCGACGCGGCATCTGTCTTCAGCCTT
TACTGTTGCAGTGGCAGCCATTGCGCTTGCGTTTTTGCACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail