Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2111
Gene name
LocationContig_171:12694..15156
Strand-
Gene length (bp)2462
Transcript length (bp)2133
Coding sequence length (bp)2133
Protein length (aa) 711

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11935 SYMPK_PTA1_N Symplekin/PTA1 N-terminal 9.3E-70 90 309

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10222|PTA1_SCHPO mRNA cleavage and polyadenylation specificity factor complex subunit pta1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pta1 PE=1 SV=2 9 660 7.0E-64
sp|Q92797|SYMPK_HUMAN Symplekin OS=Homo sapiens GN=SYMPK PE=1 SV=2 76 680 3.0E-20
sp|Q01329|PTA1_YEAST Pre-tRNA-processing protein PTA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTA1 PE=1 SV=1 515 674 2.0E-18
sp|Q80X82|SYMPK_MOUSE Symplekin OS=Mus musculus GN=Sympk PE=1 SV=1 76 680 2.0E-16
sp|Q8MSU4|SYMPK_DROME Symplekin OS=Drosophila melanogaster GN=Sym PE=1 SV=1 74 277 3.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10222|PTA1_SCHPO mRNA cleavage and polyadenylation specificity factor complex subunit pta1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pta1 PE=1 SV=2 9 660 7.0E-64
sp|Q92797|SYMPK_HUMAN Symplekin OS=Homo sapiens GN=SYMPK PE=1 SV=2 76 680 3.0E-20
sp|Q01329|PTA1_YEAST Pre-tRNA-processing protein PTA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTA1 PE=1 SV=1 515 674 2.0E-18
sp|Q80X82|SYMPK_MOUSE Symplekin OS=Mus musculus GN=Sympk PE=1 SV=1 76 680 2.0E-16
sp|Q8MSU4|SYMPK_DROME Symplekin OS=Drosophila melanogaster GN=Sym PE=1 SV=1 74 277 3.0E-10
sp|Q01329|PTA1_YEAST Pre-tRNA-processing protein PTA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PTA1 PE=1 SV=1 74 244 1.0E-09
sp|Q7ZYV9|SYMPK_XENLA Symplekin OS=Xenopus laevis GN=sympk PE=1 SV=1 487 661 1.0E-07
sp|Q7ZYV9|SYMPK_XENLA Symplekin OS=Xenopus laevis GN=sympk PE=1 SV=1 45 273 9.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2111
MASTLSVSEQIRQLNDARKLVLGDVKYYPSVVKGILPIIGPSAPVDLRRWGTDFLAEAFSTPALPNGEKETMQPY
VLATLQSLVDDEREDAHVLRSVIQTAASIYPLALRWIINNGYDTVTWDKMTAVKQRILHIWDNAVPSVRICCIKF
AQRVILAQSVAASPDLRHGGSLDVSLDKVPPSHQILDARSLEAEAMGLLDRMLGTLQESSDALLVDATLNCLSIM
VRTRPAMSGRILSALLNFNPLQAATSPLTPKSRVIVRSMEKTARMLLIHLSKRDTRNALIPRIHQHVERTMRAVA
ELFDDVGKKRPLEAHQSNGVDAKRQRTIGPHVPIQPLGPGPHTLGDVFTLISNPDLKNFDISQLPHSVVAKVSVI
ALAGLDKDALTKAVDGVRGRLDELANAPAPELNPNTAPLGVDDDDDDYEPDFYPAEDTEQILNKLDGASPKVPEE
AGGLALVSFSLGQPVELTAETALSAGSGTITRVLESIKSLEEPAARKEKAGFNRLAASSGGREGWMSILTRLATR
ASVGLEEQEVKDETGRHEQTPLLSTVIREVMYDFVMEDFRKRIDVAVSWLCEEWYNDQIRKRTGDDEVGNYEKCA
LRLLDGFLPYLNPQDKVLTRFLGEAPDLNRAMLSRVKDMCRDPSVTQLALTSLLYLAMMRPPAKEIALDTVQDIW
TDFEDARPMASKYLVKYRPEFLDEAAAAAAAAVTA*
Coding >OphauG2|2111
ATGGCTTCGACGCTGTCGGTATCAGAGCAGATTCGCCAGCTCAACGATGCCCGCAAGCTGGTGCTTGGCGATGTC
AAATACTACCCGAGCGTTGTCAAAGGCATCCTGCCCATTATTGGGCCATCAGCTCCAGTCGACCTGCGACGATGG
GGCACCGATTTCCTTGCCGAGGCCTTTTCCACGCCCGCGCTGCCCAATGGCGAAAAGGAGACGATGCAACCATAT
GTGCTCGCGACGCTGCAGTCGCTCGTTGATGATGAGCGCGAAGACGCGCACGTGCTGCGCAGCGTCATCCAAACC
GCTGCCAGCATATACCCGCTTGCCCTGCGCTGGATCATCAACAACGGATACGACACGGTTACTTGGGACAAGATG
ACTGCCGTCAAGCAGAGAATCCTACACATATGGGACAATGCGGTACCTTCGGTGCGCATATGCTGCATCAAGTTT
GCTCAGCGCGTCATTCTGGCCCAAAGCGTAGCTGCAAGTCCCGACCTGAGGCACGGCGGTTCACTCGACGTATCT
CTGGACAAGGTGCCACCGAGCCATCAAATTCTCGACGCCCGCAGCCTCGAGGCCGAAGCCATGGGTCTGCTGGAT
CGGATGCTGGGGACCTTGCAGGAAAGCAGCGATGCTCTCCTGGTAGATGCGACGCTCAACTGTCTGTCCATCATG
GTTCGCACGCGGCCAGCCATGTCGGGGCGCATCCTCAGCGCACTGCTCAACTTCAACCCGCTGCAAGCAGCCACG
TCGCCCCTGACGCCCAAGTCGCGCGTCATTGTCAGATCGATGGAGAAGACGGCGCGGATGCTGCTAATTCACCTC
AGCAAAAGAGATACGCGCAATGCGCTAATACCACGGATTCACCAGCATGTTGAGCGCACAATGCGTGCCGTGGCC
GAGCTGTTTGATGACGTGGGCAAGAAGAGGCCCTTGGAGGCTCATCAAAGCAATGGGGTGGATGCCAAACGCCAA
CGCACCATTGGGCCACATGTGCCAATCCAACCCCTGGGTCCCGGTCCACATACCCTCGGCGACGTGTTCACTCTC
ATCAGCAACCCGGACCTCAAAAACTTTGACATTTCTCAGCTGCCGCACAGCGTCGTGGCCAAGGTGTCGGTGATT
GCATTGGCCGGGCTAGATAAAGATGCCTTGACCAAAGCCGTGGATGGTGTCCGTGGCCGTCTTGATGAGCTGGCA
AATGCGCCAGCGCCAGAACTGAACCCCAATACTGCACCACTGGGCGTTGACGACGACGACGATGACTACGAACCA
GACTTTTATCCCGCCGAGGACACGGAACAGATACTCAACAAACTAGACGGGGCGTCGCCAAAGGTGCCCGAGGAA
GCAGGCGGCCTGGCGCTTGTTTCATTTAGCCTCGGCCAGCCGGTGGAGCTTACGGCCGAGACAGCACTTAGTGCA
GGAAGCGGAACCATTACGCGGGTGTTGGAATCGATCAAGTCGCTGGAGGAGCCAGCAGCGCGCAAGGAAAAGGCG
GGCTTCAACCGACTAGCTGCCAGTTCTGGGGGCCGCGAAGGCTGGATGTCGATTTTAACGCGGTTAGCAACCCGT
GCCTCGGTCGGGCTCGAGGAGCAAGAGGTCAAGGATGAAACGGGGCGACATGAGCAGACGCCATTGCTAAGCACT
GTGATACGAGAGGTCATGTATGACTTTGTCATGGAGGATTTTCGAAAGCGCATTGATGTGGCCGTCTCGTGGCTG
TGCGAAGAATGGTACAACGACCAAATCAGGAAACGGACAGGCGACGACGAGGTTGGAAACTACGAAAAGTGTGCG
CTGCGGCTGCTCGACGGGTTCTTGCCCTATCTAAACCCCCAGGACAAGGTGTTGACGCGTTTTCTCGGAGAGGCG
CCTGACCTCAACCGCGCCATGCTATCGCGGGTCAAGGACATGTGTCGAGACCCCAGTGTGACGCAACTGGCCTTG
ACGAGTCTGTTGTATCTGGCAATGATGCGTCCACCGGCCAAGGAGATTGCGCTAGATACGGTGCAGGATATATGG
ACCGACTTTGAAGATGCACGGCCCATGGCGTCCAAGTATCTGGTAAAGTATCGACCCGAGTTTCTGGACGAGGCG
GCAGCAGCAGCAGCAGCAGCAGTGACGGCATGA
Transcript >OphauG2|2111
ATGGCTTCGACGCTGTCGGTATCAGAGCAGATTCGCCAGCTCAACGATGCCCGCAAGCTGGTGCTTGGCGATGTC
AAATACTACCCGAGCGTTGTCAAAGGCATCCTGCCCATTATTGGGCCATCAGCTCCAGTCGACCTGCGACGATGG
GGCACCGATTTCCTTGCCGAGGCCTTTTCCACGCCCGCGCTGCCCAATGGCGAAAAGGAGACGATGCAACCATAT
GTGCTCGCGACGCTGCAGTCGCTCGTTGATGATGAGCGCGAAGACGCGCACGTGCTGCGCAGCGTCATCCAAACC
GCTGCCAGCATATACCCGCTTGCCCTGCGCTGGATCATCAACAACGGATACGACACGGTTACTTGGGACAAGATG
ACTGCCGTCAAGCAGAGAATCCTACACATATGGGACAATGCGGTACCTTCGGTGCGCATATGCTGCATCAAGTTT
GCTCAGCGCGTCATTCTGGCCCAAAGCGTAGCTGCAAGTCCCGACCTGAGGCACGGCGGTTCACTCGACGTATCT
CTGGACAAGGTGCCACCGAGCCATCAAATTCTCGACGCCCGCAGCCTCGAGGCCGAAGCCATGGGTCTGCTGGAT
CGGATGCTGGGGACCTTGCAGGAAAGCAGCGATGCTCTCCTGGTAGATGCGACGCTCAACTGTCTGTCCATCATG
GTTCGCACGCGGCCAGCCATGTCGGGGCGCATCCTCAGCGCACTGCTCAACTTCAACCCGCTGCAAGCAGCCACG
TCGCCCCTGACGCCCAAGTCGCGCGTCATTGTCAGATCGATGGAGAAGACGGCGCGGATGCTGCTAATTCACCTC
AGCAAAAGAGATACGCGCAATGCGCTAATACCACGGATTCACCAGCATGTTGAGCGCACAATGCGTGCCGTGGCC
GAGCTGTTTGATGACGTGGGCAAGAAGAGGCCCTTGGAGGCTCATCAAAGCAATGGGGTGGATGCCAAACGCCAA
CGCACCATTGGGCCACATGTGCCAATCCAACCCCTGGGTCCCGGTCCACATACCCTCGGCGACGTGTTCACTCTC
ATCAGCAACCCGGACCTCAAAAACTTTGACATTTCTCAGCTGCCGCACAGCGTCGTGGCCAAGGTGTCGGTGATT
GCATTGGCCGGGCTAGATAAAGATGCCTTGACCAAAGCCGTGGATGGTGTCCGTGGCCGTCTTGATGAGCTGGCA
AATGCGCCAGCGCCAGAACTGAACCCCAATACTGCACCACTGGGCGTTGACGACGACGACGATGACTACGAACCA
GACTTTTATCCCGCCGAGGACACGGAACAGATACTCAACAAACTAGACGGGGCGTCGCCAAAGGTGCCCGAGGAA
GCAGGCGGCCTGGCGCTTGTTTCATTTAGCCTCGGCCAGCCGGTGGAGCTTACGGCCGAGACAGCACTTAGTGCA
GGAAGCGGAACCATTACGCGGGTGTTGGAATCGATCAAGTCGCTGGAGGAGCCAGCAGCGCGCAAGGAAAAGGCG
GGCTTCAACCGACTAGCTGCCAGTTCTGGGGGCCGCGAAGGCTGGATGTCGATTTTAACGCGGTTAGCAACCCGT
GCCTCGGTCGGGCTCGAGGAGCAAGAGGTCAAGGATGAAACGGGGCGACATGAGCAGACGCCATTGCTAAGCACT
GTGATACGAGAGGTCATGTATGACTTTGTCATGGAGGATTTTCGAAAGCGCATTGATGTGGCCGTCTCGTGGCTG
TGCGAAGAATGGTACAACGACCAAATCAGGAAACGGACAGGCGACGACGAGGTTGGAAACTACGAAAAGTGTGCG
CTGCGGCTGCTCGACGGGTTCTTGCCCTATCTAAACCCCCAGGACAAGGTGTTGACGCGTTTTCTCGGAGAGGCG
CCTGACCTCAACCGCGCCATGCTATCGCGGGTCAAGGACATGTGTCGAGACCCCAGTGTGACGCAACTGGCCTTG
ACGAGTCTGTTGTATCTGGCAATGATGCGTCCACCGGCCAAGGAGATTGCGCTAGATACGGTGCAGGATATATGG
ACCGACTTTGAAGATGCACGGCCCATGGCGTCCAAGTATCTGGTAAAGTATCGACCCGAGTTTCTGGACGAGGCG
GCAGCAGCAGCAGCAGCAGCAGTGACGGCATGA
Gene >OphauG2|2111
ATGGCTTCGACGCTGTCGGTATCAGAGCAGATTCGCCAGCTCAACGATGCCCGCAAGCTGGTGCTTGGCGATGTC
AAATACTACCCGAGCGTTGTCAAAGGCATCCTGCCCATTATTGGGCCATCAGCTCCAGTCGACCTGCGACGATGG
GGCACCGATTTCCTTGCCGAGGCCTTTTCCACGCCCGCGCTGCCCAATGGCGAAAAGGAGACGATGCAACCATAT
GTGCTCGCGACGCTGCAGTCGCTCGTTGATGATGAGCGCGAAGACGCGCACGTGCTGCGCAGCGTCATCCAAACC
GCTGCCAGCATATACCCGCTTGCCCTGCGCTGGATGTGCGTAGTCCTGACCTGTTTGATTGCCTTGGGACTCTGG
CACTGATGATGGATCGTAGCATCAACAACGGATACGACACGGTTACTTGGGACAAGATGACTGCCGTCAAGCAGA
GAATCCTACACATATGGGACAATGCGGTACCTTCGGTGCGCATATGCTGCATCAAGTTTGCTCAGCGCGTCATTC
TGGCCCAAAGCGTAGCTGCAAGTCCCGACCTGAGGGTGCGTTTGCGCTGCCCATGATATGCCTCTTGCCTACTTG
GTGCTAAACCACGCTTACAGCACGGCGGTTCACTCGACGTATCTCTGGACAAGGTGCCACCGAGCCATCAAATTC
TCGACGCCCGCAGCCTCGAGGCCGAAGCCATGGGTCTGCTGGATCGGATGCTGGGGACCTTGCAGGAAAGCAGGT
AAAGTTTTCCCATGCTCGTTTTCGCCCTCAGTTTCTGGCTGCCAACTTGAACCCTTCCGTCATGTGACAAGCGAG
GGCTCACGCTGGTGTTTTGGTAGCGATGCTCTCCTGGTAGATGCGACGCTCAACTGTCTGTCCATCATGGTTCGC
ACGCGGCCAGCCATGTCGGGGCGCATCCTCAGCGCACTGCTCAACTTCAACCCGCTGCAAGCAGCCACGTCGCCC
CTGACGCCCAAGTCGCGCGTCATTGTCAGATCGATGGAGAAGACGGCGCGGATGCTGCTAATTCACCTCAGCAAA
AGAGATACGCGCAATGCGCTAATACCACGGATTCACCAGCATGTTGAGCGCACAATGCGTGCCGTGGCCGAGCTG
TTTGATGACGTGGGCAAGAAGAGGCCCTTGGAGGCTCATCAAAGCAATGGGGTGGATGCCAAACGCCAACGCACC
ATTGGGCCACATGTGCCAATCCAACCCCTGGGTCCCGGTCCACATACCCTCGGCGACGTGTTCACTCTCATCAGC
AACCCGGACCTCAAAAACTTTGACATTTCTCAGCTGCCGCACAGCGTCGTGGCCAAGGTGTCGGTGATTGCATTG
GCCGGGCTAGATAAAGATGCCTTGACCAAAGCCGTGGATGGTGTCCGTGGCCGTCTTGATGAGCTGGCAAATGCG
CCAGCGCCAGAACTGAACCCCAATACTGCACCACTGGGCGTTGACGACGACGACGATGACTACGAACCAGACTTT
TATCCCGCCGAGGACACGGAACAGATACTCAACAAACTAGACGGGGCGTCGCCAAAGGTGCCCGAGGAAGCAGGC
GGCCTGGCGCTTGTTTCATTTAGCCTCGGCCAGCCGGTGGAGCTTACGGCCGAGACAGCACTTAGTGCAGGAAGC
GGAACCATTACGCGGGTGTTGGAATCGATCAAGTCGCTGGAGGAGCCAGCAGCGCGCAAGGAAAAGGCGGGCTTC
AACCGACTAGCTGCCAGTTCTGGGGGCCGCGAAGGCTGGATGTCGATTTTAACGCGGTTAGCAACCCGTGCCTCG
GTCGGGCTCGAGGAGCAAGAGGTCAAGGATGAAACGGGGCGACATGAGCAGACGCCATTGCTAAGCACTGTGATA
CGAGAGGTCATGTATGACTTTGTCATGGAGGATTTTCGAAAGCGCATTGATGTGGCCGTCTCGTGGCTGTGCGAA
GAATGGTACAACGACCAAATCAGGAAACGGACAGGCGACGACGAGGTTGGAAACTACGAAAAGTGTGCGCTGCGG
CTGCTCGACGGGTTCTTGCCCTATCTAAACCCCCAGGACAAGGTGTTGACGCGTTTTCTCGGAGAGGCGCCTGAC
CTCAACCGCGCCATGCTATCGCGGGTCAAGGACATGTGTCGAGACCCCAGTGTGACGCAACTGGCCTTGACGAGT
CTGTTGTATCTGGCAATGATGCGTCCACCGGCCAAGGAGATTGCGCTAGATACGGTGCAGGATATATGGACCGAC
TGTAAGTCTTTTTCACTCTCGCCCTGCTGCTCCTCTCTTTTTCTTCTTGTCCGAGGTGTCATGCAGAGATTAGCT
GCCCTGGATTGTTGCTCTTGCTAATTACGGGGATAGTTGAAGATGCACGGCCCATGGCGTCCAAGTATCTGGTAA
AGTATCGACCCGAGTTTCTGGACGAGGCGGCAGCAGCAGCAGCAGCAGCAGTGACGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail