Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2081
Gene name
LocationContig_17:23003..26768
Strand-
Gene length (bp)3765
Transcript length (bp)3312
Coding sequence length (bp)3312
Protein length (aa) 1104

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06025 DUF913 Domain of Unknown Function (DUF913) 6.1E-125 535 955
PF06012 DUF908 Domain of Unknown Function (DUF908) 3.7E-114 119 483

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 1 1084 0.0E+00
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 46 813 3.0E-33
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 342 960 1.0E-14
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 328 827 2.0E-13
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 342 960 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P4Z1|TOM1_NEUCR E3 ubiquitin-protein ligase TOM1-like OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11B22.010 PE=3 SV=4 1 1084 0.0E+00
sp|O13834|PTR1_SCHPO E3 ubiquitin-protein ligase ptr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptr1 PE=1 SV=1 46 813 3.0E-33
sp|Q8H0T4|UPL2_ARATH E3 ubiquitin-protein ligase UPL2 OS=Arabidopsis thaliana GN=UPL2 PE=1 SV=3 342 960 1.0E-14
sp|Q756G2|TOM1_ASHGO Probable E3 ubiquitin-protein ligase TOM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOM1 PE=3 SV=2 328 827 2.0E-13
sp|Q8GY23|UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana GN=UPL1 PE=1 SV=3 342 960 3.0E-12
sp|Q03280|TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM1 PE=1 SV=1 1 184 2.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup790
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2080
Ophiocordyceps australis 1348a (Ghana) OphauG2|2081 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7487
Ophiocordyceps camponoti-floridani Ophcf2|06565
Ophiocordyceps camponoti-rufipedis Ophun1|3633
Ophiocordyceps kimflemingae Ophio5|819
Ophiocordyceps subramaniannii Hirsu2|3177
Ophiocordyceps subramaniannii Hirsu2|3178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2081
MGKITKVIQARHKETMSPWLENFVLTASEAPLPSLPKQLASFPSRWPFSRGDLYHWIPLLNRFDSILEQLCKTYN
LSQGPQPRAFGCDLLLNQCKDSIFHNEAAWNENQLMQMGYPPDGDRILAEATLEFTRMLLEHCGNRSIYASSAHL
NDLLNSTSLPILISTLKVGVELAQRYQASVKRLAQNTSRLISTALLTNHYNIDLERVQQLAMPFVKTPIASLAAT
SMYANDLVAVATSDDKQWKEWEDVKVYYFPLDIPTAPMASSDPSRSTIPTIPTTPTPLRKASTAMGAQQLSTPKS
RNIPADDSSPITPRTPVLTEDSVNPGQKLFEVPRSVVAALPLHQLVLRCPDDMPSASKYEAFNRLRVAKALGGSL
ESRRQVLAVRLLAISNLAYIHSDSNFVEKVLRHDSDETRRYQLVYQLSELIHPSTDNSIEVPLWLQSIGLSLLEA
MSGIHSKAQDLSSALNTNVNHGILLYVIRKAVAGMASDADDQDDGDHTTELDEWRNSLFSLTLHLSMQPRVGSEM
VSAGLMDALVETAFVIFLQANGLDAVSKLLVDTVADTQSWLTTSKPIGPEHRSSAVDYQIPYYKQQTLKWLTRFI
HHIMTSAYSFSGNTDRLLRNLAEKSDLLGSLRDIIQAKERYGSVVWTNSVTILSDFINNDPANYAAIMESGMIKT
FLEAVTNRSIPAHMADSKRDDSGDDEGSSDSSGISTLVGQDERPHPPSEDVLQNEERGPLAAGILASSDAINIVP
HVLSSISLNNSGMKMVVLSRAIDAFFEVFESPAHVKCLDMECDLAQNIGNNFDEFARHHPPLRPCISNAVVDLVA
RLRFLGLEKSRTAGWGAKLFIASRDGSLLSVNESGELEDASNLSPQVREQAILGDADVDMSDVVAPDESRPSKQG
NGESGAHMESITPYIHALANFLAAYLNNATLKMMFIRKGGIELLLDICESPSLPASFGESAASRVLNQVVSQLVE
QSPVRALPSLLRRAQASVDVLGPLAAKTRNLPPYFAPFLAPDLGRSRNESETSAAVVTGTTLVKGLLNAQTFIKI
IADCFVTTRSSGLSFYPVNVYDYYLTLMPAMAPLPHDPQNKSSPVRDSKIMKP*
Coding >OphauG2|2081
ATGGGCAAGATCACAAAGGTAATACAGGCTCGGCACAAGGAGACTATGTCTCCCTGGCTAGAGAACTTTGTTCTC
ACCGCATCCGAGGCTCCGTTACCTTCCTTGCCAAAGCAGCTGGCTAGCTTTCCTTCTCGATGGCCGTTCAGTCGG
GGCGATCTCTACCATTGGATTCCGCTGCTCAACCGATTCGATTCGATTCTTGAACAGCTTTGCAAAACCTACAAC
CTATCTCAAGGACCGCAGCCTCGAGCCTTTGGCTGTGACCTGCTGCTCAATCAATGCAAGGACTCCATATTTCAT
AATGAAGCAGCTTGGAATGAAAACCAGTTGATGCAGATGGGCTATCCGCCAGATGGCGATAGAATACTGGCAGAA
GCGACTCTGGAATTCACTCGCATGCTCCTAGAACACTGCGGCAACAGGAGCATCTATGCCAGCAGCGCCCATCTC
AACGACTTGCTGAATTCCACGTCTCTGCCGATCCTTATCTCCACCTTGAAGGTGGGAGTCGAACTTGCTCAGAGG
TATCAAGCGTCTGTCAAGAGGCTTGCCCAGAATACTTCTCGGCTCATCAGCACCGCTCTGTTGACCAACCACTAC
AATATCGACCTTGAACGCGTGCAGCAGCTTGCCATGCCGTTTGTCAAGACTCCAATCGCGAGTTTAGCCGCTACC
TCCATGTATGCCAACGATCTCGTGGCTGTCGCGACTTCGGATGACAAGCAATGGAAGGAGTGGGAGGACGTTAAG
GTCTATTACTTTCCGCTCGATATCCCGACTGCACCAATGGCATCCTCGGATCCTAGCCGCTCGACTATTCCAACC
ATTCCAACCACTCCCACACCGCTGCGCAAAGCTTCAACAGCCATGGGCGCTCAGCAACTCAGCACGCCTAAGTCG
CGGAATATTCCTGCTGATGATTCGTCTCCAATCACTCCACGTACCCCTGTTCTCACTGAAGATTCAGTGAACCCG
GGCCAGAAGCTGTTTGAGGTGCCGAGATCAGTTGTTGCCGCCTTGCCTTTGCATCAGCTTGTTCTGCGGTGTCCT
GATGACATGCCGTCTGCTTCCAAGTACGAGGCATTCAATCGGCTTCGAGTTGCCAAGGCCCTAGGAGGCTCTCTT
GAATCACGCCGCCAAGTTTTGGCTGTTCGACTCCTTGCTATTTCTAACTTAGCTTATATCCACTCTGACAGCAAC
TTTGTTGAAAAAGTTCTACGTCATGACAGCGACGAAACCCGAAGGTATCAACTCGTGTACCAACTTTCAGAGTTG
ATTCACCCCTCTACCGATAACAGCATCGAGGTTCCCTTATGGCTGCAGTCTATCGGCCTTAGTCTGCTTGAGGCT
ATGTCTGGCATTCACTCCAAAGCACAGGATCTCTCCTCAGCCCTCAACACCAATGTCAATCATGGAATTCTTCTC
TATGTCATCAGAAAGGCAGTTGCTGGAATGGCGAGTGATGCCGACGATCAAGATGACGGAGATCATACCACCGAA
CTTGATGAGTGGCGCAACAGCCTCTTTTCTCTGACGCTTCACTTATCTATGCAACCACGTGTTGGGAGCGAGATG
GTGTCAGCAGGTTTGATGGATGCTCTGGTAGAGACGGCCTTTGTTATTTTCCTCCAAGCAAATGGCTTGGATGCA
GTATCCAAATTGCTGGTGGACACTGTCGCCGACACACAATCCTGGCTCACTACTTCTAAGCCCATTGGGCCCGAG
CATCGTTCAAGCGCTGTCGACTATCAGATCCCTTACTACAAGCAGCAGACGCTCAAATGGCTGACCAGGTTTATA
CACCATATAATGACGAGTGCATATTCGTTCAGCGGGAATACGGATCGCCTTCTTCGGAACCTTGCCGAGAAGTCT
GATCTGTTGGGAAGTTTGCGCGACATCATTCAGGCCAAAGAGAGATATGGCTCTGTGGTATGGACAAACTCGGTC
ACTATTTTGAGCGACTTCATCAACAACGACCCGGCAAACTACGCTGCGATAATGGAGTCTGGTATGATCAAGACT
TTTCTTGAGGCGGTTACGAACCGGTCCATTCCCGCCCATATGGCCGACAGCAAGAGGGATGATAGCGGCGATGAC
GAAGGGTCCTCGGATAGCTCAGGTATCTCAACTCTGGTTGGTCAAGACGAGCGTCCCCATCCTCCTTCCGAAGAT
GTTCTGCAAAATGAAGAACGTGGCCCTTTGGCCGCTGGCATCTTAGCATCGTCGGACGCCATTAACATTGTGCCT
CACGTCCTGAGCTCCATTTCGCTTAATAACTCGGGGATGAAAATGGTGGTTCTGTCGCGAGCCATCGATGCCTTT
TTCGAGGTGTTCGAAAGCCCTGCACATGTCAAATGTCTCGACATGGAGTGTGATCTGGCGCAAAATATCGGAAAC
AACTTTGATGAGTTTGCTCGCCACCACCCGCCTCTGCGACCATGCATCTCAAATGCGGTTGTCGATCTCGTCGCG
CGCTTGCGTTTTCTTGGTCTGGAGAAATCTCGCACTGCTGGATGGGGCGCAAAACTCTTTATTGCCTCTAGAGAC
GGCTCGCTGTTATCCGTAAATGAATCCGGAGAACTGGAGGATGCTAGTAACCTTTCACCCCAAGTTCGCGAGCAA
GCCATCTTGGGCGACGCTGATGTCGACATGTCCGATGTTGTTGCTCCGGACGAGTCGAGGCCGTCAAAACAGGGC
AATGGGGAGTCGGGGGCACACATGGAGTCAATCACGCCCTATATCCACGCACTGGCCAATTTCCTCGCTGCATAC
CTGAATAACGCTACTCTCAAGATGATGTTTATCCGCAAGGGCGGCATCGAGTTGCTTTTGGACATTTGCGAATCG
CCGAGTCTTCCAGCCTCCTTTGGGGAGTCTGCAGCATCAAGGGTACTCAATCAGGTTGTGTCACAGCTAGTTGAA
CAGTCTCCTGTTCGCGCTCTCCCTTCCCTGCTGAGACGGGCTCAAGCCTCAGTGGACGTACTCGGGCCTCTAGCT
GCAAAAACTCGGAATTTGCCACCATATTTTGCGCCCTTTCTCGCACCAGACTTGGGACGCTCGCGAAATGAGTCG
GAGACATCCGCCGCCGTCGTGACTGGCACGACGCTTGTCAAAGGCCTTCTCAATGCACAAACCTTTATCAAGATT
ATAGCCGACTGCTTTGTCACGACTAGAAGCAGTGGGCTTTCTTTCTATCCCGTCAATGTCTATGATTACTACCTT
ACTCTGATGCCAGCGATGGCACCCCTGCCGCACGACCCACAGAACAAGAGCAGTCCAGTCCGCGATTCCAAAATT
ATGAAACCTTGA
Transcript >OphauG2|2081
ATGGGCAAGATCACAAAGGTAATACAGGCTCGGCACAAGGAGACTATGTCTCCCTGGCTAGAGAACTTTGTTCTC
ACCGCATCCGAGGCTCCGTTACCTTCCTTGCCAAAGCAGCTGGCTAGCTTTCCTTCTCGATGGCCGTTCAGTCGG
GGCGATCTCTACCATTGGATTCCGCTGCTCAACCGATTCGATTCGATTCTTGAACAGCTTTGCAAAACCTACAAC
CTATCTCAAGGACCGCAGCCTCGAGCCTTTGGCTGTGACCTGCTGCTCAATCAATGCAAGGACTCCATATTTCAT
AATGAAGCAGCTTGGAATGAAAACCAGTTGATGCAGATGGGCTATCCGCCAGATGGCGATAGAATACTGGCAGAA
GCGACTCTGGAATTCACTCGCATGCTCCTAGAACACTGCGGCAACAGGAGCATCTATGCCAGCAGCGCCCATCTC
AACGACTTGCTGAATTCCACGTCTCTGCCGATCCTTATCTCCACCTTGAAGGTGGGAGTCGAACTTGCTCAGAGG
TATCAAGCGTCTGTCAAGAGGCTTGCCCAGAATACTTCTCGGCTCATCAGCACCGCTCTGTTGACCAACCACTAC
AATATCGACCTTGAACGCGTGCAGCAGCTTGCCATGCCGTTTGTCAAGACTCCAATCGCGAGTTTAGCCGCTACC
TCCATGTATGCCAACGATCTCGTGGCTGTCGCGACTTCGGATGACAAGCAATGGAAGGAGTGGGAGGACGTTAAG
GTCTATTACTTTCCGCTCGATATCCCGACTGCACCAATGGCATCCTCGGATCCTAGCCGCTCGACTATTCCAACC
ATTCCAACCACTCCCACACCGCTGCGCAAAGCTTCAACAGCCATGGGCGCTCAGCAACTCAGCACGCCTAAGTCG
CGGAATATTCCTGCTGATGATTCGTCTCCAATCACTCCACGTACCCCTGTTCTCACTGAAGATTCAGTGAACCCG
GGCCAGAAGCTGTTTGAGGTGCCGAGATCAGTTGTTGCCGCCTTGCCTTTGCATCAGCTTGTTCTGCGGTGTCCT
GATGACATGCCGTCTGCTTCCAAGTACGAGGCATTCAATCGGCTTCGAGTTGCCAAGGCCCTAGGAGGCTCTCTT
GAATCACGCCGCCAAGTTTTGGCTGTTCGACTCCTTGCTATTTCTAACTTAGCTTATATCCACTCTGACAGCAAC
TTTGTTGAAAAAGTTCTACGTCATGACAGCGACGAAACCCGAAGGTATCAACTCGTGTACCAACTTTCAGAGTTG
ATTCACCCCTCTACCGATAACAGCATCGAGGTTCCCTTATGGCTGCAGTCTATCGGCCTTAGTCTGCTTGAGGCT
ATGTCTGGCATTCACTCCAAAGCACAGGATCTCTCCTCAGCCCTCAACACCAATGTCAATCATGGAATTCTTCTC
TATGTCATCAGAAAGGCAGTTGCTGGAATGGCGAGTGATGCCGACGATCAAGATGACGGAGATCATACCACCGAA
CTTGATGAGTGGCGCAACAGCCTCTTTTCTCTGACGCTTCACTTATCTATGCAACCACGTGTTGGGAGCGAGATG
GTGTCAGCAGGTTTGATGGATGCTCTGGTAGAGACGGCCTTTGTTATTTTCCTCCAAGCAAATGGCTTGGATGCA
GTATCCAAATTGCTGGTGGACACTGTCGCCGACACACAATCCTGGCTCACTACTTCTAAGCCCATTGGGCCCGAG
CATCGTTCAAGCGCTGTCGACTATCAGATCCCTTACTACAAGCAGCAGACGCTCAAATGGCTGACCAGGTTTATA
CACCATATAATGACGAGTGCATATTCGTTCAGCGGGAATACGGATCGCCTTCTTCGGAACCTTGCCGAGAAGTCT
GATCTGTTGGGAAGTTTGCGCGACATCATTCAGGCCAAAGAGAGATATGGCTCTGTGGTATGGACAAACTCGGTC
ACTATTTTGAGCGACTTCATCAACAACGACCCGGCAAACTACGCTGCGATAATGGAGTCTGGTATGATCAAGACT
TTTCTTGAGGCGGTTACGAACCGGTCCATTCCCGCCCATATGGCCGACAGCAAGAGGGATGATAGCGGCGATGAC
GAAGGGTCCTCGGATAGCTCAGGTATCTCAACTCTGGTTGGTCAAGACGAGCGTCCCCATCCTCCTTCCGAAGAT
GTTCTGCAAAATGAAGAACGTGGCCCTTTGGCCGCTGGCATCTTAGCATCGTCGGACGCCATTAACATTGTGCCT
CACGTCCTGAGCTCCATTTCGCTTAATAACTCGGGGATGAAAATGGTGGTTCTGTCGCGAGCCATCGATGCCTTT
TTCGAGGTGTTCGAAAGCCCTGCACATGTCAAATGTCTCGACATGGAGTGTGATCTGGCGCAAAATATCGGAAAC
AACTTTGATGAGTTTGCTCGCCACCACCCGCCTCTGCGACCATGCATCTCAAATGCGGTTGTCGATCTCGTCGCG
CGCTTGCGTTTTCTTGGTCTGGAGAAATCTCGCACTGCTGGATGGGGCGCAAAACTCTTTATTGCCTCTAGAGAC
GGCTCGCTGTTATCCGTAAATGAATCCGGAGAACTGGAGGATGCTAGTAACCTTTCACCCCAAGTTCGCGAGCAA
GCCATCTTGGGCGACGCTGATGTCGACATGTCCGATGTTGTTGCTCCGGACGAGTCGAGGCCGTCAAAACAGGGC
AATGGGGAGTCGGGGGCACACATGGAGTCAATCACGCCCTATATCCACGCACTGGCCAATTTCCTCGCTGCATAC
CTGAATAACGCTACTCTCAAGATGATGTTTATCCGCAAGGGCGGCATCGAGTTGCTTTTGGACATTTGCGAATCG
CCGAGTCTTCCAGCCTCCTTTGGGGAGTCTGCAGCATCAAGGGTACTCAATCAGGTTGTGTCACAGCTAGTTGAA
CAGTCTCCTGTTCGCGCTCTCCCTTCCCTGCTGAGACGGGCTCAAGCCTCAGTGGACGTACTCGGGCCTCTAGCT
GCAAAAACTCGGAATTTGCCACCATATTTTGCGCCCTTTCTCGCACCAGACTTGGGACGCTCGCGAAATGAGTCG
GAGACATCCGCCGCCGTCGTGACTGGCACGACGCTTGTCAAAGGCCTTCTCAATGCACAAACCTTTATCAAGATT
ATAGCCGACTGCTTTGTCACGACTAGAAGCAGTGGGCTTTCTTTCTATCCCGTCAATGTCTATGATTACTACCTT
ACTCTGATGCCAGCGATGGCACCCCTGCCGCACGACCCACAGAACAAGAGCAGTCCAGTCCGCGATTCCAAAATT
ATGAAACCTTGA
Gene >OphauG2|2081
ATGGGCAAGATCACAAAGGTAATACAGGCTCGGCACAAGGAGACTATGGTATGTACATCCCGTGTATTGAGAAAC
ACATTGAATTAGCCGTTCTTTGCATCTCGCATTTTCGACTGTAAGCTCTGACCATGACCTCGTGGCAGTCTCCCT
GGCTAGAGAACTTTGTTCTCACCGCATCCGAGGCTCCGTTACCTTCCTTGCCAAAGCAGCTGGCTAGCTTTCCTT
CTCGATGGCCGTTCAGTCGGGGCGATCTCTACCATTGGATTCCGCTGCTCAACCGATTCGATTCGATTCTTGAAC
AGCTTTGCAAAACCTACAACCTATCTCAAGGACCGCAGCCTCGAGCCTTTGGCTGTGACCTGCTGCTCAATCAAT
GCAAGGACTCCATATTTCATAATGAAGCAGCTTGGAATGAAAACCAGTTGATGCAGATGGGCTATCCGCCAGATG
GCGATAGAATACTGGCAGAAGCGACTCTGGAATTCACTCGCATGCTCCTAGAACACTGCGGCAACAGGAGCATCT
ATGCCAGCAGCGCCCATCTCAACGACTTGCTGAATTCCACGTCTCTGCCGATCCTTATCTCCACCTTGAAGGTGG
GAGTCGAACTTGCTCAGAGGTATCAAGCGTCTGTCAAGAGGCTTGCCCAGAATACTTCTCGGCTCATCAGCACCG
CTCTGTTGACCAACCACTACAATATCGACCTTGAACGCGTGCAGCAGCTTGCCATGCCGTTTGTCAAGACTCCAA
TCGCGAGTTTGTCCGAATCCGCGACCTTGACAACACCGGTTGCGAATAAGGGTAAGGATAAGGCTCATGGCGGGG
GTAGCAGAGCCGCTACCTCCATGTATGCCAACGATCTCGTGGCTGTCGCGACTTCGGATGACAAGCAATGGAAGG
AGTGGGAGGACGTTAAGGTCTATTACTTTCCGCTCGATATCCCGACTGCACCAATGGCATCCTCGGATCCTAGCC
GCTCGACTATTCCAACCATTCCAACCACTCCCACACCGCTGCGCAAAGCTTCAACAGCCATGGGCGCTCAGCAAC
TCAGCACGCCTAAGTCGCGGAATATTCCTGCTGATGATTCGTCTCCAATCACTCCACGTACCCCTGTTCTCACTG
AAGATTCAGTGAACCCGGGCCAGAAGCTGTTTGAGGTGCCGAGATCAGTTGTTGCCGCCTTGCCTTTGCATCAGC
TTGTTCTGCGGTGTCCTGATGACATGCCGTCTGCTTCCAAGTACGAGGCATTCAATCGGCTTCGAGTTGCCAAGG
CCCTAGGAGGCTCTCTTGAATCACGCCGCCAAGTTTTGGCTGTTCGACTCCTTGCTATTTCTAACTTAGCTTATA
TCCACTCTGACAGCAACTTTGTTGAAAAAGTTCTACGTCATGACAGCGACGAAACCCGAAGGTATCAACTCGTGT
ACCAACTTTCAGAGTTGATTCACCCCTCTACCGATAACAGCATCGAGGTTCCCTTATGGCTGCAGTCTATCGGCC
TTAGTCTGCTTGAGGCTATGTCTGGCATTCACTCCAAAGCACAGGATCTCTCCTCAGCCCTCAACACCAATGTCA
ATCATGGAATTCTTCTCTATGTCATCAGAAAGGCAGTTGCTGGAATGGCGAGTGATGCCGACGATCAAGATGACG
GAGATCATACCACCGAACTTGATGAGTGGCGCAACAGCCTCTTTTCTCTGACGCTTCACTTATCTATGCAACCAC
GTGTTGGGAGCGAGATGGTGTCAGCAGGTTTGATGGATGCTCTGGTAGAGGTACTGAGTCTCCGCACAAAAATCT
CCCAGAGGCACCATGCCATGGTGATGGCATTCTTGGACGGCTTGATTTGGTCTTTTCAGACGGCCTTTGTTATTT
TCCTCCAAGCAAATGGCTTGGATGCAGTATCCAAATTGCTGGTGGACACTGTCGCCGACACACAATCCTGGCTCA
CTACTTCTAAGCCCATTGGGCCCGAGCATCGTTCAAGCGCTGTCGACTATCAGATCCCTTACTACAAGCAGCAGA
CGCTCAAATGGCTGACCAGGTTTATACACCATATAATGACGAGTGCATATTCGTTCAGCGGGAATACGGATCGCC
TTCTTCGGAACCTTGCCGAGAAGTCTGATCTGTTGGGAAGTTTGCGCGACATCATTCAGGCCAAAGAGAGATATG
GCTCTGTGGTATGGACAAACTCGGTCACTATTTTGAGCGACTTCATCAACAACGACCCGGCAAACTACGCTGCGA
TAATGGAGTCTGGTATGATCAAGACTTTTCTTGAGGCGGTTACGAACCGGTCCATTCCCGCCCATATGGCCGACA
GCAAGAGGGATGATAGCGGCGATGACGAAGGGTCCTCGGATAGCTCAGGTATCTCAACTCTGGTTGGTCAAGACG
AGCGTCCCCATCCTCCTTCCGAAGATGTTCTGCAAAATGAAGAACGTGGCCCTTTGGCCGCTGGCATCTTAGCAT
CGTCGGACGCCATTAACATTGTGCCTCACGTCCTGAGCTCCATTTCGCTTAATAACTCGGGGATGAAAATGGTGG
TTCTGTCGCGAGCCATCGATGCCTTTTTCGAGGTGTTCGAAAGCCCTGCACATGTCAAATGTCTCGACATGGAGT
GTGATCTGGCGCAAAATATCGGAAACAACTTTGATGAGTTTGCTCGCCACCACCCGCCTCTGCGACCATGCATCT
CAAATGCGGTTGTCGATCTCGTCGCGCGCTTGCGTTTTCTTGGTCTGGAGAAATCTCGCACTGCTGGATGGGGCG
CAAAACTCTTTATTGCCTCTAGAGACGGCTCGCTGTTATCCGTAAATGAATCCGGAGAACTGGAGGATGCTAGTA
ACCTTTCACCCCAAGTTCGCGAGCAAGCCATCTTGGGCGACGCTGATGTCGACATGTCCGATGTTGTTGCTCCGG
ACGAGTCGAGGCCGTCAAAACAGGGCAATGGGGAGTCGGGGGCACACATGGAGTCAATCACGCCCTATATCCACG
CACTGGCCAATTTCCTCGCTGCATACCTGAATAACGCTACTCTCAAGATGATGTTTATCCGCAAGGGCGGCATCG
AGTTGCTTTTGGACATTTGCGAATCGCCGAGTCTTCCAGCCTCCTTTGGGGAGTCTGCAGCATCAAGGGTACTCA
ATCAGGTTGTGTCACAGCTAGTTGAACAGTCTCCTGTTCGCGCTCTCCCTTCCCTGCTGAGACGGGCTCAAGCCT
CAGTGGACGTACTCGGGCCTCTAGCTGCAAAAACTCGGAATTTGCCACCATATTTTGCGCCCTTTCTCGCACCAG
ACTTGGGACGCTCGCGAAATGAGTCGGAGACATCCGCCGCCGTCGTGACTGGCACGACGCTTGTCAAAGGCCTTC
TCAATGCACAAACCTTTATCAAGATTATAGCCGACTGCTTTGTCACGACTAGAAGCAGTGGGCTTTCTTTCTATC
CCGTCAATGTCTATGATTACTACCTTACTCTGGTTAAGTCTATCGGGCCTCTACTGCGAGGTGTCTTGGCAGAAG
AAGCGGCAGAATTGTCTGTTGTGCCTCAACATTGGTCAATGAGGCGTCATTCGTCTCTGGGCGACAACAGTACTT
CCTCGAGTGCAAACGGCGGAATGGATGATGCGCCGCTTTCAGGAGTCTTGAATGCTTCAAGCAACTGGGGCGCCA
CTACTGCAGATGCCAGCGATGGCACCCCTGCCGCACGACCCACAGAACAAGAGCAGTCCAGTCCGCGATTCCAAA
ATTATGAAACCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail