Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2077
Gene name
LocationContig_17:9414..10814
Strand+
Gene length (bp)1400
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01866 Diphthamide_syn Putative diphthamide synthesis protein 7.8E-115 117 417

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SC98|DPH1_NEUCR Diphthamide biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-1 PE=3 SV=1 1 440 0.0E+00
sp|Q4IQ72|DPH1_GIBZE Diphthamide biosynthesis protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH1 PE=3 SV=1 1 439 0.0E+00
sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph1 PE=3 SV=1 12 438 0.0E+00
sp|Q5AZJ7|DPH1_EMENI Diphthamide biosynthesis protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph1 PE=3 SV=2 17 440 0.0E+00
sp|Q6BPU5|DPH1_DEBHA Diphthamide biosynthesis protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH1 PE=3 SV=2 24 437 2.0E-168
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7SC98|DPH1_NEUCR Diphthamide biosynthesis protein 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-1 PE=3 SV=1 1 440 0.0E+00
sp|Q4IQ72|DPH1_GIBZE Diphthamide biosynthesis protein 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH1 PE=3 SV=1 1 439 0.0E+00
sp|Q4X0S7|DPH1_ASPFU Diphthamide biosynthesis protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph1 PE=3 SV=1 12 438 0.0E+00
sp|Q5AZJ7|DPH1_EMENI Diphthamide biosynthesis protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph1 PE=3 SV=2 17 440 0.0E+00
sp|Q6BPU5|DPH1_DEBHA Diphthamide biosynthesis protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH1 PE=3 SV=2 24 437 2.0E-168
sp|Q6C0S8|DPH1_YARLI Diphthamide biosynthesis protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH1 PE=3 SV=1 31 437 1.0E-167
sp|Q59MG1|DPH1_CANAL Diphthamide biosynthesis protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH1 PE=3 SV=2 25 435 1.0E-166
sp|Q75AZ9|DPH1_ASHGO Diphthamide biosynthesis protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH1 PE=3 SV=1 30 437 7.0E-163
sp|Q6FTG1|DPH1_CANGA Diphthamide biosynthesis protein 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DPH1 PE=3 SV=1 24 437 3.0E-161
sp|O59713|DPH1_SCHPO Diphthamide biosynthesis protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph1 PE=3 SV=1 32 438 1.0E-160
sp|P40487|DPH1_YEAST Diphthamide biosynthesis protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPH1 PE=1 SV=1 28 435 8.0E-160
sp|Q6CLC9|DPH1_KLULA Diphthamide biosynthesis protein 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH1 PE=3 SV=1 30 437 2.0E-159
sp|Q6GPQ5|DPH1_XENLA Diphthamide biosynthesis protein 1 OS=Xenopus laevis GN=dph1 PE=2 SV=2 46 434 7.0E-154
sp|A7SLX5|DPH1_NEMVE Diphthamide biosynthesis protein 1 OS=Nematostella vectensis GN=dph1 PE=3 SV=1 14 438 4.0E-148
sp|Q5NCQ5|DPH1_MOUSE Diphthamide biosynthesis protein 1 OS=Mus musculus GN=Dph1 PE=1 SV=1 68 434 5.0E-148
sp|Q9BZG8|DPH1_HUMAN Diphthamide biosynthesis protein 1 OS=Homo sapiens GN=DPH1 PE=1 SV=2 68 434 5.0E-147
sp|Q5ZHX9|DPH1_CHICK Diphthamide biosynthesis protein 1 OS=Gallus gallus GN=DPH1 PE=2 SV=1 72 434 5.0E-147
sp|Q3SYT1|DPH1_BOVIN Diphthamide biosynthesis protein 1 OS=Bos taurus GN=DPH1 PE=2 SV=1 55 434 6.0E-146
sp|Q54PW5|DPH1_DICDI Diphthamide biosynthesis protein 1 OS=Dictyostelium discoideum GN=dph1 PE=3 SV=1 72 432 1.0E-143
sp|Q3T7C9|DPH1_LITVA Diphthamide biosynthesis protein 1 OS=Litopenaeus vannamei PE=1 SV=1 59 438 4.0E-141
sp|P49958|DPH1_CAEEL Diphthamide biosynthesis protein 1 OS=Caenorhabditis elegans GN=dph-1 PE=3 SV=2 63 434 8.0E-131
sp|Q567W6|DPH1_DANRE Diphthamide biosynthesis protein 1 OS=Danio rerio GN=dph1 PE=2 SV=1 47 378 5.0E-125
sp|Q4PA25|DPH1_USTMA Diphthamide biosynthesis protein 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DPH1 PE=3 SV=1 27 438 1.0E-122
sp|P0CN18|DPH1_CRYNJ Diphthamide biosynthesis protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPH1 PE=3 SV=1 12 434 5.0E-117
sp|P0CN19|DPH1_CRYNB Diphthamide biosynthesis protein 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPH1 PE=3 SV=1 12 434 5.0E-117
sp|Q8SUZ5|DPH1_ENCCU Diphthamide biosynthesis protein 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DPH1 PE=3 SV=2 77 434 4.0E-100
sp|Q6DE00|DPH2_XENLA Diphthamide biosynthesis protein 2 OS=Xenopus laevis GN=dph2 PE=2 SV=1 96 416 2.0E-29
sp|Q10206|DPH2_SCHPO Diphthamide biosynthesis protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dph2 PE=3 SV=1 96 416 1.0E-28
sp|P0CN20|DPH2_CRYNJ Diphthamide biosynthesis protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DPH2 PE=3 SV=1 96 435 5.0E-26
sp|P0CN21|DPH2_CRYNB Diphthamide biosynthesis protein 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DPH2 PE=3 SV=1 96 435 5.0E-26
sp|A4QN59|DPH2_DANRE Diphthamide biosynthesis protein 2 OS=Danio rerio GN=dph2 PE=2 SV=1 96 427 1.0E-24
sp|Q5ZKI2|DPH2_CHICK Diphthamide biosynthesis protein 2 OS=Gallus gallus GN=DPH2 PE=2 SV=1 96 427 6.0E-24
sp|A7SKJ3|DPH2_NEMVE Diphthamide biosynthesis protein 2 OS=Nematostella vectensis GN=dph2 PE=3 SV=1 96 428 9.0E-23
sp|O58832|DPH2_PYRHO 2-(3-amino-3-carboxypropyl)histidine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=dph2 PE=1 SV=1 97 419 1.0E-21
sp|Q57907|DPH2_METJA 2-(3-amino-3-carboxypropyl)histidine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=dph2 PE=3 SV=1 94 410 2.0E-21
sp|Q4I5M4|DPH2_GIBZE Diphthamide biosynthesis protein 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DPH2 PE=3 SV=1 96 422 2.0E-17
sp|Q59SJ9|DPH2_CANAL Diphthamide biosynthesis protein 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DPH2 PE=3 SV=1 111 427 7.0E-17
sp|Q4WN99|DPH2_ASPFU Diphthamide biosynthesis protein 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dph2 PE=3 SV=1 57 410 8.0E-15
sp|B0G132|DPH2_DICDI Diphthamide biosynthesis protein 2 OS=Dictyostelium discoideum GN=dph2 PE=3 SV=1 96 189 8.0E-15
sp|Q08DM2|DPH2_BOVIN Diphthamide biosynthesis protein 2 OS=Bos taurus GN=DPH2 PE=2 SV=1 96 405 5.0E-14
sp|Q568Y2|DPH2_RAT Diphthamide biosynthesis protein 2 OS=Rattus norvegicus GN=Dph2 PE=2 SV=1 96 430 5.0E-14
sp|Q002B5|DPH2_CRIGR Diphthamide biosynthesis protein 2 OS=Cricetulus griseus GN=DPH2 PE=2 SV=1 96 430 3.0E-13
sp|Q9CR25|DPH2_MOUSE Diphthamide biosynthesis protein 2 OS=Mus musculus GN=Dph2 PE=1 SV=1 96 430 5.0E-13
sp|Q5RE82|DPH2_PONAB Diphthamide biosynthesis protein 2 OS=Pongo abelii GN=DPH2 PE=2 SV=1 96 405 7.0E-13
sp|Q757B6|DPH2_ASHGO Diphthamide biosynthesis protein 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DPH2 PE=3 SV=1 138 427 8.0E-13
sp|Q9BQC3|DPH2_HUMAN Diphthamide biosynthesis protein 2 OS=Homo sapiens GN=DPH2 PE=1 SV=1 96 405 3.0E-12
sp|Q6BMF6|DPH2_DEBHA Diphthamide biosynthesis protein 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DPH2 PE=3 SV=2 143 417 3.0E-12
sp|Q09454|DPH2_CAEEL Diphthamide biosynthesis protein 2 OS=Caenorhabditis elegans GN=dph-2 PE=3 SV=2 96 421 2.0E-10
sp|Q6CGE7|DPH2_YARLI Diphthamide biosynthesis protein 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPH2 PE=3 SV=1 105 419 2.0E-10
sp|Q6CS90|DPH2_KLULA Diphthamide biosynthesis protein 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DPH2 PE=3 SV=1 143 417 3.0E-10
sp|Q7S5C0|DPH2_NEUCR Diphthamide biosynthesis protein 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dph-2 PE=3 SV=1 143 237 2.0E-08
sp|Q5B2Q1|DPH2_EMENI Diphthamide biosynthesis protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dph2 PE=3 SV=1 79 237 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0017183 peptidyl-diphthamide biosynthetic process from peptidyl-histidine Yes
GO:0090560 2-(3-amino-3-carboxypropyl)histidine synthase activity Yes
GO:0050789 regulation of biological process No
GO:0043412 macromolecule modification No
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups No
GO:0008152 metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0080090 regulation of primary metabolic process No
GO:0006448 regulation of translational elongation No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0009889 regulation of biosynthetic process No
GO:0017182 peptidyl-diphthamide metabolic process No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No
GO:1900247 regulation of cytoplasmic translational elongation No
GO:0019222 regulation of metabolic process No
GO:0018202 peptidyl-histidine modification No
GO:2000112 regulation of cellular macromolecule biosynthetic process No
GO:0018193 peptidyl-amino acid modification No
GO:0003674 molecular_function No
GO:0031326 regulation of cellular biosynthetic process No
GO:0034248 regulation of cellular amide metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0006417 regulation of translation No
GO:0051246 regulation of protein metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0050794 regulation of cellular process No
GO:0016740 transferase activity No
GO:0044249 cellular biosynthetic process No
GO:0010608 post-transcriptional regulation of gene expression No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0065007 biological regulation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2077
MEDDRARVDVGAAADIEEAQQIQEEANSVKQPKKRFVGRRTAARLNGASSSEATSCALEPATARRAPRLLNRVPK
EIADDELLNQAIGLLPANYNFEIHKTIHRIRSSGARRVALQMPEGLLMFATTISDIVTQFCPGAETLIMGDVTYG
ACCIDDYTARALGCDLLVHYAHSCLVPVDVTRIKTLYVFVDIALDTSHLLASLERNLASGSTIALVGTIQFNATI
HGVTGALRAAGFGVVVPQIAPLSKGEILGCTSPRLDESQRVDMILYLGDGRFHLESIMIHNPSVPAYRYDPYSRR
LTRETYNHDEMSSLRLDAIRQARTARRWGLILGSLGRQGNPHTMALIERRLAERGIPYVNLLLSEIFPGKLASMA
DVECWVQVACPRLSIDWGYAFARPLLTPYEALVALGLRREWALEGGVYPMDYYAKDGLGRTRPLAT*
Coding >OphauG2|2077
ATGGAAGACGACCGAGCAAGAGTCGATGTGGGCGCGGCAGCCGACATCGAAGAGGCTCAGCAAATACAAGAGGAA
GCAAACAGCGTCAAGCAGCCAAAGAAGCGCTTCGTGGGCAGACGCACGGCAGCCCGACTAAACGGAGCCAGCAGC
AGCGAAGCAACAAGCTGCGCACTGGAGCCGGCAACGGCGCGACGGGCGCCCAGGCTGCTCAACAGAGTGCCCAAG
GAGATTGCCGACGACGAGCTTCTCAACCAAGCCATTGGGCTGCTGCCGGCCAACTACAACTTTGAGATTCACAAG
ACCATCCACCGCATCCGCTCGTCGGGGGCGCGGCGCGTGGCGTTGCAGATGCCCGAGGGACTGCTCATGTTTGCC
ACCACCATCTCAGACATTGTGACGCAATTCTGCCCGGGCGCCGAGACGCTCATCATGGGCGATGTCACGTACGGC
GCCTGCTGTATCGACGACTACACGGCCCGTGCTCTGGGCTGCGACCTGCTGGTGCACTATGCACACAGCTGCCTG
GTTCCCGTTGACGTGACGCGCATCAAGACGCTCTACGTCTTTGTCGACATTGCCCTGGACACGTCCCATCTGCTG
GCGTCGCTGGAGCGCAACCTGGCGTCGGGCAGCACCATTGCCCTTGTCGGCACCATCCAGTTCAATGCCACCATA
CACGGCGTCACTGGCGCGCTCAGGGCTGCCGGCTTTGGCGTCGTGGTGCCGCAGATTGCGCCCCTGAGCAAGGGC
GAGATCCTCGGCTGCACGTCGCCGCGTCTCGACGAGAGCCAGCGCGTCGACATGATTCTCTACCTGGGCGATGGC
CGCTTCCACCTCGAGAGCATCATGATTCACAACCCGTCAGTCCCGGCCTACCGCTACGACCCTTATTCCCGCAGA
CTGACGCGCGAGACCTACAACCACGACGAGATGAGCTCGCTGCGCCTCGACGCCATTCGCCAGGCCCGCACCGCC
CGCCGCTGGGGACTCATTCTTGGCTCGCTGGGCCGCCAGGGCAATCCTCACACCATGGCCCTGATTGAGCGGCGC
CTGGCCGAGCGCGGCATCCCCTACGTCAACCTGCTGCTCAGCGAAATCTTTCCCGGCAAGCTTGCCTCCATGGCC
GACGTGGAGTGCTGGGTTCAGGTGGCGTGTCCGCGTCTCAGCATCGACTGGGGCTACGCCTTTGCCCGCCCACTG
CTGACGCCCTACGAGGCTCTGGTTGCCCTGGGCCTACGTCGGGAATGGGCCCTCGAGGGCGGCGTCTACCCCATG
GACTATTATGCCAAGGACGGGCTGGGCAGGACAAGGCCCCTGGCCACCTGA
Transcript >OphauG2|2077
ATGGAAGACGACCGAGCAAGAGTCGATGTGGGCGCGGCAGCCGACATCGAAGAGGCTCAGCAAATACAAGAGGAA
GCAAACAGCGTCAAGCAGCCAAAGAAGCGCTTCGTGGGCAGACGCACGGCAGCCCGACTAAACGGAGCCAGCAGC
AGCGAAGCAACAAGCTGCGCACTGGAGCCGGCAACGGCGCGACGGGCGCCCAGGCTGCTCAACAGAGTGCCCAAG
GAGATTGCCGACGACGAGCTTCTCAACCAAGCCATTGGGCTGCTGCCGGCCAACTACAACTTTGAGATTCACAAG
ACCATCCACCGCATCCGCTCGTCGGGGGCGCGGCGCGTGGCGTTGCAGATGCCCGAGGGACTGCTCATGTTTGCC
ACCACCATCTCAGACATTGTGACGCAATTCTGCCCGGGCGCCGAGACGCTCATCATGGGCGATGTCACGTACGGC
GCCTGCTGTATCGACGACTACACGGCCCGTGCTCTGGGCTGCGACCTGCTGGTGCACTATGCACACAGCTGCCTG
GTTCCCGTTGACGTGACGCGCATCAAGACGCTCTACGTCTTTGTCGACATTGCCCTGGACACGTCCCATCTGCTG
GCGTCGCTGGAGCGCAACCTGGCGTCGGGCAGCACCATTGCCCTTGTCGGCACCATCCAGTTCAATGCCACCATA
CACGGCGTCACTGGCGCGCTCAGGGCTGCCGGCTTTGGCGTCGTGGTGCCGCAGATTGCGCCCCTGAGCAAGGGC
GAGATCCTCGGCTGCACGTCGCCGCGTCTCGACGAGAGCCAGCGCGTCGACATGATTCTCTACCTGGGCGATGGC
CGCTTCCACCTCGAGAGCATCATGATTCACAACCCGTCAGTCCCGGCCTACCGCTACGACCCTTATTCCCGCAGA
CTGACGCGCGAGACCTACAACCACGACGAGATGAGCTCGCTGCGCCTCGACGCCATTCGCCAGGCCCGCACCGCC
CGCCGCTGGGGACTCATTCTTGGCTCGCTGGGCCGCCAGGGCAATCCTCACACCATGGCCCTGATTGAGCGGCGC
CTGGCCGAGCGCGGCATCCCCTACGTCAACCTGCTGCTCAGCGAAATCTTTCCCGGCAAGCTTGCCTCCATGGCC
GACGTGGAGTGCTGGGTTCAGGTGGCGTGTCCGCGTCTCAGCATCGACTGGGGCTACGCCTTTGCCCGCCCACTG
CTGACGCCCTACGAGGCTCTGGTTGCCCTGGGCCTACGTCGGGAATGGGCCCTCGAGGGCGGCGTCTACCCCATG
GACTATTATGCCAAGGACGGGCTGGGCAGGACAAGGCCCCTGGCCACCTGA
Gene >OphauG2|2077
ATGGAAGACGACCGAGCAAGAGTCGATGTGGGCGCGGCAGCCGACATCGAAGAGGCTCAGCAAATACAAGAGGAA
GCAAACAGCGTCAAGCAGCCAAAGAAGCGCTTCGTGGGCAGACGCACGGCAGCCCGACTAAACGGAGCCAGCAGC
AGCGAAGCAACAAGCTGCGCACTGGAGCGTGGGTAACATGACAATGCTGCGGCCCCATTTGACAGGCCGGAATGA
CATGCTGACATGTTGATGGGTGGACAGCGGCAACGGCGCGACGGGCGCCCAGGCTGCTCAACAGAGTGCCCAAGG
AGATTGCCGACGACGAGCTTCTCAACCAAGCCATTGGGCTGCTGCCGGCCAACTACAACTTTGAGATTCACAAGA
CCATCCACCGCATCCGCTCGTCGGGGGCGCGGCGCGTGGCGTTGCAGATGCCCGAGGGACTGCTCATGTTTGCCA
CCACCATCTCAGACATTGTGACGCAATTCTGCCCGGGCGCCGAGACGCTCATCATGGGCGATGTCACGTACGGCG
CCTGCTGTATCGACGACTACACGGCCCGTGCTCTGGGCTGCGACCTGCTGGTGCACTATGCACACAGCTGCCTGG
TTCCCGTTGACGTGACGCGCATCAAGACGCTCTACGTCTTTGTCGACATTGCCCTGGACACGTCCCATCTGCTGG
CGTCGCTGGAGCGCAACCTGGCGTCGGGCAGCACCATTGCCCTTGTCGGCACCATCCAGTTCAATGCCACCATAC
ACGGCGTCACTGGCGCGCTCAGGGCTGCCGGCTTTGGCGTCGTGGTGCCGCAGATTGCGCCCCTGAGCAAGGGCG
AGATCCTCGGCTGCACGTCGCCGCGTCTCGACGAGAGCCAGCGCGTCGACATGATTCTCTACCTGGGCGATGGCC
GCTTCCACCTCGAGAGCATCATGATTCACAACCCGTCAGTCCCGGCCTACCGCTACGACCCTTATTCCCGCAGAC
TGACGCGCGAGACCTACAACCACGACGAGATGAGCTCGCTGCGCCTCGACGCCATTCGCCAGGCCCGCACCGCCC
GCCGCTGGGGACTCATTCTTGGCTCGCTGGGCCGCCAGGGCAATCCTCACACCATGGCCCTGATTGAGCGGCGCC
TGGCCGAGCGCGGCATCCCCTACGTCAACCTGCTGCTCAGCGAAATCTTTCCCGGCAAGCTTGCCTCCATGGCCG
ACGTGGAGTGCTGGGTTCAGGTGGCGTGTCCGCGTCTCAGCATCGACTGGGGCTACGCCTTTGCCCGCCCACTGC
TGACGCCCTACGAGGCTCTGGTTGCCCTGGGCCTACGTCGGGAATGGGCCCTCGAGGGCGGCGTCTACCCCATGG
ACTATTATGCCAAGGACGGGCTGGGCAGGACAAGGCCCCTGGCCACCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail