Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2074
Gene name
LocationContig_17:2908..4096
Strand+
Gene length (bp)1188
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00682 HMGL-like HMGL-like 1.1E-09 37 127
PF00682 HMGL-like HMGL-like 1.6E-30 155 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I2A0|LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=liuE PE=1 SV=1 35 350 4.0E-95
sp|P13703|HMGCL_PSEMV Hydroxymethylglutaryl-CoA lyase OS=Pseudomonas mevalonii GN=mvaB PE=3 SV=1 35 363 4.0E-90
sp|P35915|HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus GN=HMGCL PE=1 SV=1 35 355 1.0E-88
sp|Q29448|HMGCL_BOVIN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Bos taurus GN=HMGCL PE=2 SV=2 35 355 8.0E-87
sp|Q8JZS7|HMGC2_MOUSE 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Mus musculus GN=Hmgcll1 PE=2 SV=1 24 360 6.0E-85
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9I2A0|LIUE_PSEAE 3-hydroxy-3-isohexenylglutaryl-CoA/hydroxy-methylglutaryl-CoA lyase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=liuE PE=1 SV=1 35 350 4.0E-95
sp|P13703|HMGCL_PSEMV Hydroxymethylglutaryl-CoA lyase OS=Pseudomonas mevalonii GN=mvaB PE=3 SV=1 35 363 4.0E-90
sp|P35915|HMGCL_CHICK Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Gallus gallus GN=HMGCL PE=1 SV=1 35 355 1.0E-88
sp|Q29448|HMGCL_BOVIN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Bos taurus GN=HMGCL PE=2 SV=2 35 355 8.0E-87
sp|Q8JZS7|HMGC2_MOUSE 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Mus musculus GN=Hmgcll1 PE=2 SV=1 24 360 6.0E-85
sp|D4A5C3|HMGC2_RAT 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Rattus norvegicus GN=Hmgcll1 PE=1 SV=1 16 360 9.0E-85
sp|Q8HXZ6|HMGCL_MACFA Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Macaca fascicularis GN=HMGCL PE=2 SV=1 35 355 1.0E-84
sp|Q5R9E1|HMGCL_PONAB Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Pongo abelii GN=HMGCL PE=2 SV=1 35 355 2.0E-83
sp|P97519|HMGCL_RAT Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Rattus norvegicus GN=Hmgcl PE=2 SV=1 16 355 3.0E-83
sp|O81027|HMGCL_ARATH Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Arabidopsis thaliana GN=HMGCL PE=1 SV=2 35 370 3.0E-82
sp|P38060|HMGCL_MOUSE Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Mus musculus GN=Hmgcl PE=1 SV=2 35 355 3.0E-82
sp|P35914|HMGCL_HUMAN Hydroxymethylglutaryl-CoA lyase, mitochondrial OS=Homo sapiens GN=HMGCL PE=1 SV=2 35 355 3.0E-82
sp|A8WG57|HMGC2_DANRE 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Danio rerio GN=hmgcll1 PE=2 SV=1 31 355 4.0E-82
sp|Q8TB92|HMGC2_HUMAN 3-hydroxymethyl-3-methylglutaryl-CoA lyase, cytoplasmic OS=Homo sapiens GN=HMGCLL1 PE=1 SV=3 37 359 6.0E-80
sp|O34873|HMGCL_BACSU Hydroxymethylglutaryl-CoA lyase YngG OS=Bacillus subtilis (strain 168) GN=yngG PE=1 SV=1 35 346 2.0E-71
sp|A9WGE2|CCL_CHLAA (R)-citramalyl-CoA lyase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=ccl PE=1 SV=1 35 355 3.0E-56
sp|A8AB61|LEU1_IGNH4 Probable 2-isopropylmalate synthase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=leuA PE=3 SV=1 35 361 1.0E-10
sp|B9E371|LEU1_CLOK1 2-isopropylmalate synthase OS=Clostridium kluyveri (strain NBRC 12016) GN=leuA PE=3 SV=1 35 321 1.0E-09
sp|A5MZ76|LEU1_CLOK5 2-isopropylmalate synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=leuA PE=3 SV=1 35 321 1.0E-09
sp|Q8ZW35|LEU1_PYRAE Probable 2-isopropylmalate synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuA PE=3 SV=1 156 345 6.0E-09
sp|B1I1Y1|LEU1_DESAP 2-isopropylmalate synthase OS=Desulforudis audaxviator (strain MP104C) GN=leuA PE=3 SV=1 34 354 7.0E-09
sp|B8I1T7|LEU1_CLOCE 2-isopropylmalate synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=leuA PE=3 SV=1 35 321 1.0E-08
sp|B9KB95|LEU1_THENN 2-isopropylmalate synthase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=leuA PE=3 SV=1 35 357 2.0E-08
sp|B0TCR1|LEU1_HELMI 2-isopropylmalate synthase OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=leuA PE=3 SV=1 34 354 3.0E-08
sp|Q39ED5|LEU1_BURL3 2-isopropylmalate synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=leuA PE=3 SV=1 39 370 5.0E-08
sp|Q8EN67|LEU1_OCEIH 2-isopropylmalate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=leuA PE=3 SV=1 37 361 6.0E-08
sp|Q8TW28|AKSA_METKA Putative homocitrate synthase AksA OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aksA PE=3 SV=1 156 371 9.0E-08
sp|Q9RUA9|LEU1_DEIRA 2-isopropylmalate synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuA PE=3 SV=1 25 328 9.0E-08
sp|Q57926|AKSA_METJA Probable homocitrate synthase AksA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aksA PE=1 SV=3 172 361 1.0E-07
sp|B1L8U2|LEU1_THESQ 2-isopropylmalate synthase OS=Thermotoga sp. (strain RQ2) GN=leuA PE=3 SV=1 35 357 1.0E-07
sp|Q9WZ23|LEU1_THEMA 2-isopropylmalate synthase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=leuA PE=3 SV=1 35 357 1.0E-07
sp|Q8RCF9|LEU12_CALS4 2-isopropylmalate synthase 2 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=leuA2 PE=3 SV=1 32 361 1.0E-07
sp|B4E5N2|LEU1_BURCJ 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=leuA PE=3 SV=1 39 361 2.0E-07
sp|O59390|HOSA_PYRHO Putative homocitrate synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH1727 PE=3 SV=1 156 298 2.0E-07
sp|A4JGE0|LEU1_BURVG 2-isopropylmalate synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=leuA PE=3 SV=1 39 361 3.0E-07
sp|Q2LWJ3|LEU1_SYNAS 2-isopropylmalate synthase OS=Syntrophus aciditrophicus (strain SB) GN=leuA PE=3 SV=1 32 361 3.0E-07
sp|Q1BV03|LEU1_BURCA 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=leuA PE=3 SV=1 39 361 3.0E-07
sp|A0K933|LEU1_BURCH 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain HI2424) GN=leuA PE=3 SV=1 39 361 3.0E-07
sp|B1JVQ1|LEU1_BURCC 2-isopropylmalate synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=leuA PE=3 SV=1 39 361 3.0E-07
sp|A9AJN4|LEU1_BURM1 2-isopropylmalate synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=leuA PE=3 SV=1 39 361 4.0E-07
sp|A5IJM2|LEU1_THEP1 2-isopropylmalate synthase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=leuA PE=3 SV=1 35 357 4.0E-07
sp|D3DJ41|2OCL_HYDTT 2-oxoglutarate carboxylase large subunit OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=cfiA PE=1 SV=1 34 353 4.0E-07
sp|Q9JZG1|LEU1_NEIMB 2-isopropylmalate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=leuA PE=1 SV=1 32 329 5.0E-07
sp|P94565|LEU1_BACSU 2-isopropylmalate synthase OS=Bacillus subtilis (strain 168) GN=leuA PE=3 SV=1 35 353 6.0E-07
sp|Q764S0|HOA_BACPJ 4-hydroxy-2-oxovalerate aldolase OS=Bacillus sp. (strain JF8) GN=nahM PE=3 SV=2 204 344 6.0E-07
sp|Q0BDB9|LEU1_BURCM 2-isopropylmalate synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=leuA PE=3 SV=1 39 361 7.0E-07
sp|B1HR98|LEU1_LYSSC 2-isopropylmalate synthase OS=Lysinibacillus sphaericus (strain C3-41) GN=leuA PE=3 SV=1 35 361 7.0E-07
sp|Q65GI8|LEU1_BACLD 2-isopropylmalate synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=leuA PE=3 SV=1 45 298 7.0E-07
sp|A3NT94|LEU1_BURP0 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain 1106a) GN=leuA PE=3 SV=1 39 361 8.0E-07
sp|Q3JUB9|LEU1_BURP1 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain 1710b) GN=leuA PE=3 SV=1 39 361 8.0E-07
sp|Q63VP3|LEU1_BURPS 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain K96243) GN=leuA PE=3 SV=1 39 361 8.0E-07
sp|B1YTR7|LEU1_BURA4 2-isopropylmalate synthase OS=Burkholderia ambifaria (strain MC40-6) GN=leuA PE=3 SV=1 39 361 8.0E-07
sp|A3N7K7|LEU1_BURP6 2-isopropylmalate synthase OS=Burkholderia pseudomallei (strain 668) GN=leuA PE=3 SV=1 39 361 8.0E-07
sp|C1AVG2|HOA4_RHOOB 4-hydroxy-2-oxovalerate aldolase 4 OS=Rhodococcus opacus (strain B4) GN=ROP_54050 PE=3 SV=1 30 346 1.0E-06
sp|A3PDH0|LEU1_PROM0 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=leuA PE=3 SV=1 37 316 1.0E-06
sp|C0Z9C8|LEU1_BREBN 2-isopropylmalate synthase OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=leuA PE=3 SV=1 35 321 2.0E-06
sp|Q9JUK6|LEU1_NEIMA 2-isopropylmalate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=leuA PE=3 SV=1 32 329 3.0E-06
sp|A1KTV6|LEU1_NEIMF 2-isopropylmalate synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=leuA PE=3 SV=1 32 329 3.0E-06
sp|Q8DJ32|LEU1_THEEB 2-isopropylmalate synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuA PE=3 SV=1 31 323 4.0E-06
sp|A4IRH8|LEU1_GEOTN 2-isopropylmalate synthase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=leuA PE=3 SV=1 35 361 4.0E-06
sp|A7Z7B8|LEU1_BACMF 2-isopropylmalate synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=leuA PE=3 SV=1 35 298 4.0E-06
sp|Q0S9W9|HOA2_RHOJR 4-hydroxy-2-oxovalerate aldolase 2 OS=Rhodococcus jostii (strain RHA1) GN=RHA1_ro03867 PE=3 SV=1 34 346 5.0E-06
sp|P94907|LEU1_MICAE 2-isopropylmalate synthase OS=Microcystis aeruginosa GN=leuA PE=3 SV=1 37 323 5.0E-06
sp|A8G5D5|LEU1_PROM2 2-isopropylmalate synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=leuA PE=3 SV=1 37 316 5.0E-06
sp|A8FFW5|LEU11_BACP2 2-isopropylmalate synthase 1 OS=Bacillus pumilus (strain SAFR-032) GN=leuA1 PE=3 SV=1 45 298 5.0E-06
sp|Q9C550|LEU12_ARATH 2-isopropylmalate synthase 2, chloroplastic OS=Arabidopsis thaliana GN=IPMS2 PE=1 SV=1 37 329 5.0E-06
sp|C1B8I0|HOA2_RHOOB 4-hydroxy-2-oxovalerate aldolase 2 OS=Rhodococcus opacus (strain B4) GN=ROP_37360 PE=3 SV=1 30 346 5.0E-06
sp|B0JGK2|LEU1_MICAN 2-isopropylmalate synthase OS=Microcystis aeruginosa (strain NIES-843) GN=leuA PE=3 SV=1 37 323 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5197
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2074 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7493
Ophiocordyceps camponoti-floridani Ophcf2|06572
Ophiocordyceps camponoti-rufipedis Ophun1|6474
Ophiocordyceps kimflemingae Ophio5|289
Ophiocordyceps subramaniannii Hirsu2|4030

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2074
MNCFRSTLCTVCRQSQRQLGRGFATASTRSPSQNKTVKIVEVGPRDGLQNEQQTINLSTKIELIERLAKTGVSTI
EAGSFVSPKWVPQMANSDEIMTHILKNKIKSTLPISYAFLAPNTKGLQNASELLAKYQGQFATQHEPNNESGANP
KPTIEVAVFAAATESFSQKNLNCSVQESLERFKEVIRDSKGLGLRVRAYISVVLGCPFEGFDVDAHRVAEIATDL
LESGADEISLGDTTGMGTAPRTSTLLRCMTAAGIRNEDIAMHFHDTYGQALVNTAVSLEHGIRTFDTSVGGLGGC
PYSPGATGNVATENMVYFMETLGMDTGIDLDAMADIGAWITGELGKANDSSVGKAVLGARSRKMTGGTEKA*
Coding >OphauG2|2074
ATGAATTGTTTTCGCTCGACCTTGTGCACCGTCTGTAGACAGTCTCAGAGGCAACTCGGGCGAGGCTTCGCCACG
GCTAGTACAAGAAGCCCGTCGCAGAACAAGACGGTCAAGATTGTCGAGGTTGGCCCGCGCGATGGCTTGCAAAAC
GAGCAACAAACGATAAACTTGAGCACAAAAATCGAGTTGATTGAGCGGCTGGCTAAAACGGGCGTCTCTACAATC
GAAGCTGGCTCGTTTGTGTCTCCGAAATGGGTTCCTCAGATGGCCAATTCAGATGAGATCATGACGCATATCTTG
AAAAACAAAATCAAGTCGACTTTGCCCATTAGCTACGCATTCCTGGCGCCAAACACCAAGGGACTGCAAAACGCA
TCAGAGCTGCTAGCCAAGTACCAAGGCCAATTTGCAACGCAGCACGAACCAAACAACGAATCGGGAGCCAATCCG
AAACCCACGATTGAAGTAGCCGTGTTTGCTGCAGCAACGGAGAGCTTTTCACAAAAGAACCTCAACTGCAGCGTA
CAGGAGTCGCTGGAGCGGTTCAAGGAGGTTATACGGGACTCCAAGGGACTGGGACTACGAGTCCGGGCATATATT
TCTGTCGTGCTTGGGTGTCCGTTTGAAGGTTTCGATGTTGATGCGCATCGCGTGGCCGAGATTGCCACTGATCTG
CTGGAATCCGGAGCGGACGAGATCTCTCTCGGTGATACAACAGGAATGGGCACGGCGCCACGAACAAGCACGCTT
TTGCGGTGCATGACAGCGGCGGGTATCCGAAACGAGGATATTGCCATGCACTTCCACGACACGTACGGGCAGGCA
CTTGTAAATACGGCCGTCTCTCTCGAACACGGTATCCGAACCTTTGATACTAGTGTCGGCGGACTGGGGGGATGC
CCATATAGCCCGGGTGCAACGGGAAACGTTGCGACCGAAAACATGGTGTACTTTATGGAGACGCTGGGAATGGAC
ACTGGCATAGATTTGGATGCCATGGCTGATATTGGCGCCTGGATCACAGGCGAGCTTGGAAAAGCCAATGATAGC
TCAGTGGGCAAGGCCGTTCTTGGGGCAAGGTCCAGAAAGATGACTGGTGGTACTGAAAAGGCATAG
Transcript >OphauG2|2074
ATGAATTGTTTTCGCTCGACCTTGTGCACCGTCTGTAGACAGTCTCAGAGGCAACTCGGGCGAGGCTTCGCCACG
GCTAGTACAAGAAGCCCGTCGCAGAACAAGACGGTCAAGATTGTCGAGGTTGGCCCGCGCGATGGCTTGCAAAAC
GAGCAACAAACGATAAACTTGAGCACAAAAATCGAGTTGATTGAGCGGCTGGCTAAAACGGGCGTCTCTACAATC
GAAGCTGGCTCGTTTGTGTCTCCGAAATGGGTTCCTCAGATGGCCAATTCAGATGAGATCATGACGCATATCTTG
AAAAACAAAATCAAGTCGACTTTGCCCATTAGCTACGCATTCCTGGCGCCAAACACCAAGGGACTGCAAAACGCA
TCAGAGCTGCTAGCCAAGTACCAAGGCCAATTTGCAACGCAGCACGAACCAAACAACGAATCGGGAGCCAATCCG
AAACCCACGATTGAAGTAGCCGTGTTTGCTGCAGCAACGGAGAGCTTTTCACAAAAGAACCTCAACTGCAGCGTA
CAGGAGTCGCTGGAGCGGTTCAAGGAGGTTATACGGGACTCCAAGGGACTGGGACTACGAGTCCGGGCATATATT
TCTGTCGTGCTTGGGTGTCCGTTTGAAGGTTTCGATGTTGATGCGCATCGCGTGGCCGAGATTGCCACTGATCTG
CTGGAATCCGGAGCGGACGAGATCTCTCTCGGTGATACAACAGGAATGGGCACGGCGCCACGAACAAGCACGCTT
TTGCGGTGCATGACAGCGGCGGGTATCCGAAACGAGGATATTGCCATGCACTTCCACGACACGTACGGGCAGGCA
CTTGTAAATACGGCCGTCTCTCTCGAACACGGTATCCGAACCTTTGATACTAGTGTCGGCGGACTGGGGGGATGC
CCATATAGCCCGGGTGCAACGGGAAACGTTGCGACCGAAAACATGGTGTACTTTATGGAGACGCTGGGAATGGAC
ACTGGCATAGATTTGGATGCCATGGCTGATATTGGCGCCTGGATCACAGGCGAGCTTGGAAAAGCCAATGATAGC
TCAGTGGGCAAGGCCGTTCTTGGGGCAAGGTCCAGAAAGATGACTGGTGGTACTGAAAAGGCATAG
Gene >OphauG2|2074
ATGAATTGTTTTCGCTCGACCTTGTGCACCGTCTGTAGACAGTCTCAGAGGCAACTCGGGCGAGGCTTCGCCACG
GCTAGTACAAGAAGCCCGTCGCAGAACAAGACGGTCAAGATTGTCGAGGTTGGCCCGCGCGATGGCTTGCAAAAC
GAGCAACAAACGATAAACTTGAGCACAAAAATCGAGTTGATTGAGCGGCTGGCTAAAACGGGCGTCTCTACAATC
GAAGCTGGCTCGTTTGTGTCTCCGAAATGGGTTCCTCAGGTGAGTCTAGATCACCCCGAGGTATAACAGGCTAGG
TGTCAAATGTGTGCTCATGTTCAAGTACGGGGACAGATGGCCAATTCAGATGAGATCATGACGCATATCTTGAAA
AACAAAATCAAGTCGACTTTGCCCATTAGCTACGCATTCCTGGCGCCAAACACCAAGGGACTGCAAAACGCATCA
GAGCTGCTAGCCAAGTACCAAGGCCAATTTGCAACGCAGCACGAACCAAACAACGAATCGGGAGCCAATCCGAAA
CCCACGATTGAAGTAGCCGTGTTTGCTGCAGCAACGGAGAGCTTTTCACAAAAGAACCTCAACTGCAGCGTACAG
GAGTCGCTGGAGCGGTTCAAGGAGGTTATACGGGACTCCAAGGGACTGGGACTACGAGTCCGGGCATATATTTCT
GTCGTGCTTGGGTGTCCGTTTGAAGGTTTCGATGTTGATGCGCATCGCGTGGCCGAGATTGCCACTGATCTGCTG
GAATCCGGAGCGGACGAGATCTCTCTCGGTGATACAACAGGAATGGGCACGGCGCCACGAACAAGCACGCTTTTG
CGGTGCATGACAGCGGCGGGTATCCGAAACGAGGATATTGCCATGCACTTCCACGACACGTACGGGCAGGCACTT
GTAAATACGGCCGTCTCTCTCGAACACGGTATCCGAACCTTTGATACTAGTGTCGGCGGACTGGGGGGATGCCCA
TATAGCCCGGGTGCAACGGGAAACGTTGCGACCGAAAACATGGTGTACTTTATGGAGACGCTGGGAATGGACACT
GGCATAGATTTGGATGCCATGGCTGATATTGGCGCCTGGATCACAGGCGAGCTTGGAAAAGCCAATGATAGCTCA
GTGGGCAAGGCCGTTCTTGGGGCAAGGTCCAGAAAGATGACTGGTGGTACTGAAAAGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail