Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2063
Gene name
LocationContig_169:21738..22837
Strand-
Gene length (bp)1099
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8IXT5|RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens GN=RBM12B PE=1 SV=2 210 299 2.0E-06
sp|Q8IXT5|RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens GN=RBM12B PE=1 SV=2 210 299 2.0E-06
sp|Q5UPJ3|YL116_MIMIV Uncharacterized protein L116 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L116 PE=3 SV=1 195 293 3.0E-06
sp|Q8IXT5|RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens GN=RBM12B PE=1 SV=2 206 299 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2063
MRSQAVAVASALAGTASLVQATNYNPPCPSVTVTGEVCPTCPVKECLDIETITANKQCPYPIPTTTTSYPCYQPH
NKCPTGCASTSYVTVGPTPGYPNPSYTKPSYTKPSYTKPSYTKPDNTPSPMPTLPTHVNPENPCPTLTHTRSVCS
TCIRPLCITIETLSCAKGCPTPVPTVYTEIGCHQKCPGGCATQYELASNCGSRSTHNAYPPPASSNYPPPASSNY
PPPASSNYPPPASSNYPPPASSNYPPPASSNYPPPASSNYPPPASSNYPPPASSNYPPPASSNYPPPAYNPYPPP
RF*
Coding >OphauG2|2063
ATGCGTTCTCAGGCAGTGGCTGTTGCCTCGGCACTCGCTGGCACCGCCAGCCTCGTCCAAGCAACCAACTACAAC
CCTCCCTGTCCATCCGTCACCGTCACCGGAGAGGTCTGCCCAACTTGCCCCGTCAAGGAATGCCTCGACATTGAA
ACCATTACCGCCAACAAGCAATGCCCCTATCCGATTCCCACCACCACCACCTCGTATCCATGCTACCAGCCGCAC
AACAAGTGCCCTACTGGCTGCGCTTCGACCTCTTATGTCACTGTTGGTCCAACACCGGGCTATCCCAACCCGAGC
TATACCAAGCCCAGTTATACCAAGCCCAGCTATACCAAGCCAAGCTATACCAAGCCCGACAATACGCCCTCGCCC
ATGCCCACGCTGCCCACCCATGTCAACCCAGAGAATCCGTGCCCGACACTCACTCACACTCGCAGCGTCTGCTCG
ACCTGTATTCGCCCGTTGTGTATTACCATTGAGACCCTGAGCTGTGCCAAGGGATGCCCGACCCCGGTGCCTACG
GTTTATACAGAGATTGGCTGCCACCAAAAGTGCCCTGGTGGATGTGCTACGCAGTATGAGCTTGCTAGCAACTGT
GGCTCAAGATCGACCCACAATGCCTACCCTCCTCCAGCTTCTTCCAATTATCCTCCCCCCGCTTCCTCCAACTAC
CCTCCTCCCGCTTCCTCCAACTATCCTCCTCCAGCTTCCTCCAACTACCCTCCTCCAGCTTCTTCTAATTATCCC
CCTCCAGCTTCCTCCAACTACCCTCCTCCAGCTTCCTCCAACTACCCTCCTCCCGCTTCCTCCAACTACCCTCCT
CCCGCTTCTTCTAATTATCCTCCTCCAGCTTCCTCCAACTATCCTCCCCCAGCTTACAACCCATACCCTCCCCCG
AGATTCTAA
Transcript >OphauG2|2063
ATGCGTTCTCAGGCAGTGGCTGTTGCCTCGGCACTCGCTGGCACCGCCAGCCTCGTCCAAGCAACCAACTACAAC
CCTCCCTGTCCATCCGTCACCGTCACCGGAGAGGTCTGCCCAACTTGCCCCGTCAAGGAATGCCTCGACATTGAA
ACCATTACCGCCAACAAGCAATGCCCCTATCCGATTCCCACCACCACCACCTCGTATCCATGCTACCAGCCGCAC
AACAAGTGCCCTACTGGCTGCGCTTCGACCTCTTATGTCACTGTTGGTCCAACACCGGGCTATCCCAACCCGAGC
TATACCAAGCCCAGTTATACCAAGCCCAGCTATACCAAGCCAAGCTATACCAAGCCCGACAATACGCCCTCGCCC
ATGCCCACGCTGCCCACCCATGTCAACCCAGAGAATCCGTGCCCGACACTCACTCACACTCGCAGCGTCTGCTCG
ACCTGTATTCGCCCGTTGTGTATTACCATTGAGACCCTGAGCTGTGCCAAGGGATGCCCGACCCCGGTGCCTACG
GTTTATACAGAGATTGGCTGCCACCAAAAGTGCCCTGGTGGATGTGCTACGCAGTATGAGCTTGCTAGCAACTGT
GGCTCAAGATCGACCCACAATGCCTACCCTCCTCCAGCTTCTTCCAATTATCCTCCCCCCGCTTCCTCCAACTAC
CCTCCTCCCGCTTCCTCCAACTATCCTCCTCCAGCTTCCTCCAACTACCCTCCTCCAGCTTCTTCTAATTATCCC
CCTCCAGCTTCCTCCAACTACCCTCCTCCAGCTTCCTCCAACTACCCTCCTCCCGCTTCCTCCAACTACCCTCCT
CCCGCTTCTTCTAATTATCCTCCTCCAGCTTCCTCCAACTATCCTCCCCCAGCTTACAACCCATACCCTCCCCCG
AGATTCTAA
Gene >OphauG2|2063
ATGCGTTCTCAGGCAGTGGCTGTTGCCTCGGCACTCGCTGGGTAAGGCTCATTCACTCTTCTCTGCTTTCCCTTG
GTTACAGGCTCGTAATTACTAGAGAGGCTACAATCTCCTTTTTTTTTGCCCTCTTCGACTTGATTTTGTCTCGAT
AATCTTCATCTTTTTTACTCCCCCCCCCCTTGCTTTCGTAAACTTGATTCTTACCTCCTTTTACTAACACTTAAA
AAAAAGCACCGCCAGCCTCGTCCAAGCAACCAACTACAACCCTCCCTGTCCATCCGTCACCGTCACCGGAGAGGT
CTGCCCAACTTGCCCCGTCAAGGAATGCCTCGACATTGAAACCATTACCGCCAACAAGCAATGCCCCTATCCGAT
TCCCACCACCACCACCTCGTATCCATGCTACCAGCCGCACAACAAGTGCCCTACTGGCTGCGCTTCGACCTCTTA
TGTCACTGTTGGTCCAACACCGGGCTATCCCAACCCGAGCTATACCAAGCCCAGTTATACCAAGCCCAGCTATAC
CAAGCCAAGCTATACCAAGCCCGACAATACGCCCTCGCCCATGCCCACGCTGCCCACCCATGTCAACCCAGAGAA
TCCGTGCCCGACACTCACTCACACTCGCAGCGTCTGCTCGACCTGTATTCGCCCGTTGTGTATTACCATTGAGAC
CCTGAGCTGTGCCAAGGGATGCCCGACCCCGGTGCCTACGGTTTATACAGAGATTGGCTGCCACCAAAAGTGCCC
TGGTGGATGTGCTACGCAGTATGAGCTTGCTAGCAACTGTGGCTCAAGATCGACCCACAATGCCTACCCTCCTCC
AGCTTCTTCCAATTATCCTCCCCCCGCTTCCTCCAACTACCCTCCTCCCGCTTCCTCCAACTATCCTCCTCCAGC
TTCCTCCAACTACCCTCCTCCAGCTTCTTCTAATTATCCCCCTCCAGCTTCCTCCAACTACCCTCCTCCAGCTTC
CTCCAACTACCCTCCTCCCGCTTCCTCCAACTACCCTCCTCCCGCTTCTTCTAATTATCCTCCTCCAGCTTCCTC
CAACTATCCTCCCCCAGCTTACAACCCATACCCTCCCCCGAGATTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail