Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2055
Gene name
LocationContig_169:9476..10205
Strand+
Gene length (bp)729
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.780229

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup108
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2055 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|4948
Ophiocordyceps australis 1348a (Ghana) OphauG2|5391
Ophiocordyceps australis map64 (Brazil) OphauB2|1787
Ophiocordyceps australis map64 (Brazil) OphauB2|3127
Ophiocordyceps australis map64 (Brazil) OphauB2|3128
Ophiocordyceps australis map64 (Brazil) OphauB2|3183
Ophiocordyceps australis map64 (Brazil) OphauB2|3335
Ophiocordyceps camponoti-floridani Ophcf2|00223
Ophiocordyceps camponoti-rufipedis Ophun1|875
Ophiocordyceps kimflemingae Ophio5|6442
Ophiocordyceps subramaniannii Hirsu2|10638
Ophiocordyceps subramaniannii Hirsu2|2917
Ophiocordyceps subramaniannii Hirsu2|6025

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2055
MKPRQLFVLFMGITYAIHPRTLRINKSEAEEAETNTIGVDENDKLNIMLNKRSHPGPSGRSSIDFRAAKMAPSSS
KQGEFFRGDSRSPTGVFSKGFSPKGSDMDLKKHLSFAGNSGYVSLTRSKSTAETYAFGRTGEKKSVGYVYKVAPS
ESARGFWVPGMYKGPEVSRNQEFAVAGKVPAQNIQGAYSVDSKNPKSPKQWVPNKNFAQSSALPKPWEKLVSDIA
RVNFGSKAKKGDPGHRN*
Coding >OphauG2|2055
ATGAAGCCACGTCAGCTGTTTGTACTATTCATGGGGATTACCTATGCAATACATCCTCGTACTCTCCGAATCAAC
AAGTCGGAGGCCGAAGAAGCAGAAACGAATACCATAGGCGTCGACGAGAACGACAAGCTGAATATAATGTTAAAC
AAGCGCAGCCACCCGGGTCCTTCGGGTAGGTCCAGTATAGACTTCAGGGCTGCCAAGATGGCACCGTCTTCAAGC
AAACAGGGCGAGTTTTTTCGAGGTGATTCCCGGTCCCCAACCGGTGTGTTTTCAAAGGGCTTTTCGCCCAAGGGC
TCCGATATGGACCTCAAGAAACATCTTAGCTTTGCGGGGAACAGTGGTTACGTCTCGCTTACTCGCTCCAAGTCA
ACGGCTGAGACTTATGCCTTTGGCCGAACGGGGGAGAAGAAAAGTGTCGGTTACGTTTACAAGGTCGCTCCGAGT
GAATCAGCCCGTGGCTTCTGGGTCCCCGGCATGTACAAGGGGCCCGAAGTGTCTAGGAACCAGGAGTTTGCGGTA
GCTGGTAAAGTCCCCGCACAGAATATCCAGGGCGCCTATTCTGTGGATTCCAAAAACCCAAAGTCTCCAAAGCAG
TGGGTGCCCAATAAAAACTTTGCCCAGAGCTCTGCTTTGCCCAAGCCATGGGAGAAGTTGGTTAGTGACATAGCA
AGGGTAAATTTCGGTTCCAAGGCCAAGAAAGGCGATCCAGGCCATCGCAATTGA
Transcript >OphauG2|2055
ATGAAGCCACGTCAGCTGTTTGTACTATTCATGGGGATTACCTATGCAATACATCCTCGTACTCTCCGAATCAAC
AAGTCGGAGGCCGAAGAAGCAGAAACGAATACCATAGGCGTCGACGAGAACGACAAGCTGAATATAATGTTAAAC
AAGCGCAGCCACCCGGGTCCTTCGGGTAGGTCCAGTATAGACTTCAGGGCTGCCAAGATGGCACCGTCTTCAAGC
AAACAGGGCGAGTTTTTTCGAGGTGATTCCCGGTCCCCAACCGGTGTGTTTTCAAAGGGCTTTTCGCCCAAGGGC
TCCGATATGGACCTCAAGAAACATCTTAGCTTTGCGGGGAACAGTGGTTACGTCTCGCTTACTCGCTCCAAGTCA
ACGGCTGAGACTTATGCCTTTGGCCGAACGGGGGAGAAGAAAAGTGTCGGTTACGTTTACAAGGTCGCTCCGAGT
GAATCAGCCCGTGGCTTCTGGGTCCCCGGCATGTACAAGGGGCCCGAAGTGTCTAGGAACCAGGAGTTTGCGGTA
GCTGGTAAAGTCCCCGCACAGAATATCCAGGGCGCCTATTCTGTGGATTCCAAAAACCCAAAGTCTCCAAAGCAG
TGGGTGCCCAATAAAAACTTTGCCCAGAGCTCTGCTTTGCCCAAGCCATGGGAGAAGTTGGTTAGTGACATAGCA
AGGGTAAATTTCGGTTCCAAGGCCAAGAAAGGCGATCCAGGCCATCGCAATTGA
Gene >OphauG2|2055
ATGAAGCCACGTCAGCTGTTTGTACTATTCATGGGGATTACCTATGCAATACATCCTCGTACTCTCCGAATCAAC
AAGTCGGAGGCCGAAGAAGCAGAAACGAATACCATAGGCGTCGACGAGAACGACAAGCTGAATATAATGTTAAAC
AAGCGCAGCCACCCGGGTCCTTCGGGTAGGTCCAGTATAGACTTCAGGGCTGCCAAGATGGCACCGTCTTCAAGC
AAACAGGGCGAGTTTTTTCGAGGTGATTCCCGGTCCCCAACCGGTGTGTTTTCAAAGGGCTTTTCGCCCAAGGGC
TCCGATATGGACCTCAAGAAACATCTTAGCTTTGCGGGGAACAGTGGTTACGTCTCGCTTACTCGCTCCAAGTCA
ACGGCTGAGACTTATGCCTTTGGCCGAACGGGGGAGAAGAAAAGTGTCGGTTACGTTTACAAGGTCGCTCCGAGT
GAATCAGCCCGTGGCTTCTGGGTCCCCGGCATGTACAAGGGGCCCGAAGTGTCTAGGAACCAGGAGTTTGCGGTA
GCTGGTAAAGTCCCCGCACAGAATATCCAGGGCGCCTATTCTGTGGATTCCAAAAACCCAAAGTCTCCAAAGCAG
TGGGTGCCCAATAAAAACTTTGCCCAGAGCTCTGCTTTGCCCAAGCCATGGGAGAAGTTGGTTAGTGACATAGCA
AGGGTAAATTTCGGTTCCAAGGCCAAGAAAGGCGATCCAGGCCATCGCAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail