Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2049
Gene name
LocationContig_1686:33..613
Strand-
Gene length (bp)580
Transcript length (bp)459
Coding sequence length (bp)459
Protein length (aa) 153

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain 2.4E-31 5 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7B2S5|LCDH_NOCDD L-carnitine dehydrogenase OS=Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / IMRU 509 / JCM 7437 / NCTC 10488) GN=lcdH PE=3 SV=1 2 152 1.0E-42
sp|Q93RX5|LCDH_STRCO L-carnitine dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lcdH PE=3 SV=1 3 152 6.0E-41
sp|B1VLT7|LCDH_STRGG L-carnitine dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lcdH PE=3 SV=1 3 152 3.0E-40
sp|Q9HTH8|LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lcdH PE=1 SV=1 3 152 1.0E-39
sp|Q88R32|LCDH_PSEPK L-carnitine dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lcdH PE=3 SV=1 3 152 2.0E-39
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7B2S5|LCDH_NOCDD L-carnitine dehydrogenase OS=Nocardiopsis dassonvillei (strain ATCC 23218 / DSM 43111 / IMRU 509 / JCM 7437 / NCTC 10488) GN=lcdH PE=3 SV=1 2 152 1.0E-42
sp|Q93RX5|LCDH_STRCO L-carnitine dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=lcdH PE=3 SV=1 3 152 6.0E-41
sp|B1VLT7|LCDH_STRGG L-carnitine dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=lcdH PE=3 SV=1 3 152 3.0E-40
sp|Q9HTH8|LCDH_PSEAE L-carnitine dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lcdH PE=1 SV=1 3 152 1.0E-39
sp|Q88R32|LCDH_PSEPK L-carnitine dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lcdH PE=3 SV=1 3 152 2.0E-39
sp|D7URM0|LCDH_PSESP L-carnitine dehydrogenase OS=Pseudomonas sp. GN=lcdH PE=1 SV=1 3 152 1.0E-38
sp|Q62DG4|LCDH_BURMA L-carnitine dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=lcdH PE=3 SV=2 3 152 5.0E-37
sp|Q63MT0|LCDH_BURPS L-carnitine dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=lcdH PE=3 SV=1 3 152 1.0E-36
sp|Q4V182|LCDH_BACCZ L-carnitine dehydrogenase OS=Bacillus cereus (strain ZK / E33L) GN=lcdH PE=3 SV=1 2 152 1.0E-36
sp|Q4ZSC0|LCDH_PSEU2 L-carnitine dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lcdH PE=3 SV=1 3 152 2.0E-33
sp|Q8CUW0|LCDH_OCEIH L-carnitine dehydrogenase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=lcdH PE=3 SV=1 3 152 4.0E-31
sp|Q8CQB9|LCDH_STAES L-carnitine dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=lcdH PE=3 SV=1 7 152 3.0E-30
sp|Q92NF5|LCDH_RHIME L-carnitine dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=lcdH PE=3 SV=1 3 152 3.0E-23
sp|D7UNT2|LCDH_RHISP L-carnitine dehydrogenase OS=Rhizobium sp. GN=lcdH PE=1 SV=1 3 152 8.0E-23
sp|Q98CR3|LCDH_RHILO L-carnitine dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=lcdH PE=3 SV=1 18 152 1.0E-20
sp|P52041|HBD_CLOAB 3-hydroxybutyryl-CoA dehydrogenase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=hbd PE=1 SV=2 3 152 2.0E-14
sp|Q5LTH8|LCDH_RUEPO L-carnitine dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=lcdH PE=3 SV=1 22 152 3.0E-14
sp|Q7D3B2|LCDH_AGRFC L-carnitine dehydrogenase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=lcdH PE=3 SV=2 22 148 9.0E-14
sp|Q9Y2S2|CRYL1_HUMAN Lambda-crystallin homolog OS=Homo sapiens GN=CRYL1 PE=1 SV=3 5 152 2.0E-12
sp|Q5RDZ2|CRYL1_PONAB Lambda-crystallin homolog OS=Pongo abelii GN=CRYL1 PE=2 SV=3 5 152 2.0E-12
sp|P77851|HBD_THETC 3-hydroxybutyryl-CoA dehydrogenase OS=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 9385 / NCA 3814) GN=hbd PE=3 SV=2 3 152 3.0E-11
sp|Q8SPX7|CRYL1_BOVIN Lambda-crystallin homolog OS=Bos taurus GN=CRYL1 PE=2 SV=3 6 152 5.0E-11
sp|P14755|CRYL1_RABIT Lambda-crystallin OS=Oryctolagus cuniculus GN=CRYL1 PE=1 SV=3 6 152 1.0E-10
sp|Q68WH7|FAD3_RICTY Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=RT0547 PE=3 SV=1 3 152 1.0E-10
sp|Q7N288|FADJ_PHOLL Fatty acid oxidation complex subunit alpha OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fadJ PE=3 SV=2 39 152 1.0E-10
sp|Q9ZCZ1|FAD3_RICPR Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia prowazekii (strain Madrid E) GN=RP560 PE=3 SV=1 3 152 4.0E-10
sp|Q811X6|CRYL1_RAT Lambda-crystallin homolog OS=Rattus norvegicus GN=Cryl1 PE=1 SV=3 6 152 2.0E-09
sp|P9WNP7|FADB2_MYCTU 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadB2 PE=1 SV=1 2 152 2.0E-09
sp|P9WNP6|FADB2_MYCTO 3-hydroxybutyryl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadB2 PE=3 SV=1 2 152 2.0E-09
sp|Q4UL32|FAD3_RICFE Putative fatty acid oxidation complex trifunctional enzyme OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0890 PE=3 SV=1 3 152 3.0E-09
sp|Q8W1L6|MFP_ORYSJ Peroxisomal fatty acid beta-oxidation multifunctional protein OS=Oryza sativa subsp. japonica GN=MFP PE=1 SV=2 3 152 3.0E-09
sp|Q8SQ26|CRYL1_PIG Lambda-crystallin homolog OS=Sus scrofa GN=CRYL1 PE=2 SV=3 6 152 5.0E-09
sp|Q9ZPI6|AIM1_ARATH Peroxisomal fatty acid beta-oxidation multifunctional protein AIM1 OS=Arabidopsis thaliana GN=AIM1 PE=1 SV=1 3 152 5.0E-09
sp|Q9DBM2|ECHP_MOUSE Peroxisomal bifunctional enzyme OS=Mus musculus GN=Ehhadh PE=1 SV=4 3 152 1.0E-08
sp|Q99KP3|CRYL1_MOUSE Lambda-crystallin homolog OS=Mus musculus GN=Cryl1 PE=1 SV=3 6 152 3.0E-08
sp|Q45223|HBD_BRADU 3-hydroxybutyryl-CoA dehydrogenase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=hbdA PE=3 SV=1 3 152 9.0E-08
sp|A1JK30|FADJ_YERE8 Fatty acid oxidation complex subunit alpha OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=fadJ PE=3 SV=2 26 152 2.0E-07
sp|Q8X8I2|FADB_ECO57 Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 GN=fadB PE=3 SV=1 76 152 2.0E-07
sp|B5YY93|FADB_ECO5E Fatty acid oxidation complex subunit alpha OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=fadB PE=3 SV=1 76 152 2.0E-07
sp|C3K613|FADB_PSEFS Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain SBW25) GN=fadB PE=3 SV=1 78 152 2.0E-07
sp|B5XVW2|FADJ_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadJ PE=3 SV=1 26 152 2.0E-07
sp|Q93Q12|FADB_PSEOL Fatty acid oxidation complex subunit alpha OS=Pseudomonas oleovorans GN=fadB PE=3 SV=1 78 152 2.0E-07
sp|A5W6H0|FADB_PSEP1 Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=fadB PE=3 SV=1 78 152 2.0E-07
sp|A8GH86|FADJ_SERP5 Fatty acid oxidation complex subunit alpha OS=Serratia proteamaculans (strain 568) GN=fadJ PE=3 SV=2 39 152 2.0E-07
sp|Q9AHY3|FADB_PSEPU Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida GN=fadB PE=3 SV=2 78 152 2.0E-07
sp|B7NV20|FADB_ECO7I Fatty acid oxidation complex subunit alpha OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=fadB PE=3 SV=1 76 152 2.0E-07
sp|B7NFE7|FADB_ECOLU Fatty acid oxidation complex subunit alpha OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=fadB PE=3 SV=1 76 152 2.0E-07
sp|Q88L02|FADB_PSEPK Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain KT2440) GN=fadB PE=3 SV=1 78 152 2.0E-07
sp|B1J5A5|FADB_PSEPW Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain W619) GN=fadB PE=3 SV=1 78 152 2.0E-07
sp|B0KH74|FADB_PSEPG Fatty acid oxidation complex subunit alpha OS=Pseudomonas putida (strain GB-1) GN=fadB PE=3 SV=1 78 152 2.0E-07
sp|P28793|FADB_PSEFR Fatty acid oxidation complex subunit alpha OS=Pseudomonas fragi GN=fadB PE=1 SV=1 78 152 3.0E-07
sp|P55100|ECHP_CAVPO Peroxisomal bifunctional enzyme OS=Cavia porcellus GN=EHHADH PE=2 SV=2 3 152 3.0E-07
sp|A4VKA3|FADB_PSEU5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas stutzeri (strain A1501) GN=fadB PE=3 SV=1 78 152 3.0E-07
sp|Q8BMS1|ECHA_MOUSE Trifunctional enzyme subunit alpha, mitochondrial OS=Mus musculus GN=Hadha PE=1 SV=1 3 152 3.0E-07
sp|P83589|HCDH_DEIRA Probable 3-hydroxyacyl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=DR_2477 PE=1 SV=2 1 152 3.0E-07
sp|Q92HC9|Y842_RICCN Putative uncharacterized protein RC0842 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=RC0842 PE=5 SV=1 3 145 3.0E-07
sp|Q1I7D4|FADB_PSEE4 Fatty acid oxidation complex subunit alpha OS=Pseudomonas entomophila (strain L48) GN=fadB PE=3 SV=1 78 152 6.0E-07
sp|Q4KFC4|FADB_PSEF5 Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=fadB PE=3 SV=1 78 152 8.0E-07
sp|Q1CHK2|FADJ_YERPN Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=fadJ PE=3 SV=2 26 152 9.0E-07
sp|Q8ZD45|FADJ_YERPE Fatty acid oxidation complex subunit alpha OS=Yersinia pestis GN=fadJ PE=3 SV=2 26 152 9.0E-07
sp|Q1C660|FADJ_YERPA Fatty acid oxidation complex subunit alpha OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=fadJ PE=3 SV=2 26 152 9.0E-07
sp|A7FGK1|FADJ_YERP3 Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=fadJ PE=3 SV=1 26 152 9.0E-07
sp|Q9HZJ2|FADB_PSEAE Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fadB PE=3 SV=1 78 152 9.0E-07
sp|Q02PH8|FADB_PSEAB Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fadB PE=3 SV=1 78 152 9.0E-07
sp|B7UYR6|FADB_PSEA8 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain LESB58) GN=fadB PE=3 SV=1 78 152 9.0E-07
sp|A6V382|FADB_PSEA7 Fatty acid oxidation complex subunit alpha OS=Pseudomonas aeruginosa (strain PA7) GN=fadB PE=3 SV=1 78 152 9.0E-07
sp|Q668V1|FADJ_YERPS Fatty acid oxidation complex subunit alpha OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=fadJ PE=3 SV=2 26 152 9.0E-07
sp|Q3K9D8|FADB_PSEPF Fatty acid oxidation complex subunit alpha OS=Pseudomonas fluorescens (strain Pf0-1) GN=fadB PE=3 SV=1 78 152 9.0E-07
sp|A8A2L0|FADJ_ECOHS Fatty acid oxidation complex subunit alpha OS=Escherichia coli O9:H4 (strain HS) GN=fadJ PE=3 SV=1 3 152 1.0E-06
sp|P45364|HBD_PEPDI 3-hydroxybutyryl-CoA dehydrogenase OS=Peptoclostridium difficile GN=hbd PE=3 SV=1 6 152 1.0E-06
sp|A4TM82|FADJ_YERPP Fatty acid oxidation complex subunit alpha OS=Yersinia pestis (strain Pestoides F) GN=fadJ PE=3 SV=1 26 152 1.0E-06
sp|Q6FF68|FADB_ACIAD Fatty acid oxidation complex subunit alpha OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=fadB PE=3 SV=1 78 152 1.0E-06
sp|P07896|ECHP_RAT Peroxisomal bifunctional enzyme OS=Rattus norvegicus GN=Ehhadh PE=1 SV=2 3 152 2.0E-06
sp|C6DAL7|FADJ_PECCP Fatty acid oxidation complex subunit alpha OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=fadJ PE=3 SV=1 39 152 2.0E-06
sp|A7MS61|FADJ_VIBCB Fatty acid oxidation complex subunit alpha OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=fadJ PE=3 SV=1 71 152 2.0E-06
sp|Q8DB47|FADJ_VIBVU Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain CMCP6) GN=fadJ PE=3 SV=1 71 152 2.0E-06
sp|Q7MIS5|FADJ_VIBVY Fatty acid oxidation complex subunit alpha OS=Vibrio vulnificus (strain YJ016) GN=fadJ PE=3 SV=1 71 152 2.0E-06
sp|A7MH81|FADJ_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadJ PE=3 SV=1 38 152 3.0E-06
sp|Q9RVG1|HBD_DEIRA Probable 3-hydroxybutyryl-CoA dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=hbd PE=3 SV=1 7 152 3.0E-06
sp|A4XSM8|FADB_PSEMY Fatty acid oxidation complex subunit alpha OS=Pseudomonas mendocina (strain ymp) GN=fadB PE=3 SV=1 78 152 3.0E-06
sp|Q48GW3|FADB_PSE14 Fatty acid oxidation complex subunit alpha OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=fadB PE=3 SV=1 78 152 3.0E-06
sp|B8E3R3|FADB_SHEB2 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS223) GN=fadB PE=3 SV=1 82 152 3.0E-06
sp|A4Y1B6|FADB_SHEPC Fatty acid oxidation complex subunit alpha OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=fadB PE=3 SV=1 82 152 4.0E-06
sp|B5XYH0|FADB_KLEP3 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae (strain 342) GN=fadB PE=3 SV=1 94 152 4.0E-06
sp|Q87ZB2|FADB_PSESM Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=fadB PE=3 SV=1 78 152 4.0E-06
sp|Q4ZRA0|FADB_PSEU2 Fatty acid oxidation complex subunit alpha OS=Pseudomonas syringae pv. syringae (strain B728a) GN=fadB PE=3 SV=1 78 152 4.0E-06
sp|Q4FQC6|FADB_PSYA2 Fatty acid oxidation complex subunit alpha OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=fadB PE=3 SV=1 78 152 4.0E-06
sp|A6WHA0|FADB_SHEB8 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS185) GN=fadB PE=3 SV=1 82 152 4.0E-06
sp|A1RDW6|FADB_SHESW Fatty acid oxidation complex subunit alpha OS=Shewanella sp. (strain W3-18-1) GN=fadB PE=3 SV=1 82 152 4.0E-06
sp|A9KU91|FADB_SHEB9 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS195) GN=fadB PE=3 SV=1 82 152 4.0E-06
sp|A3CYJ4|FADB_SHEB5 Fatty acid oxidation complex subunit alpha OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=fadB PE=3 SV=1 82 152 5.0E-06
sp|A7MQP0|FADB_CROS8 Fatty acid oxidation complex subunit alpha OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=fadB PE=3 SV=1 94 152 5.0E-06
sp|B0VE45|FADB_ACIBY Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AYE) GN=fadB PE=3 SV=1 78 152 7.0E-06
sp|B2I2J9|FADB_ACIBC Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain ACICU) GN=fadB PE=3 SV=1 78 152 7.0E-06
sp|B7I3P1|FADB_ACIB5 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB0057) GN=fadB PE=3 SV=1 78 152 7.0E-06
sp|B7H1I0|FADB_ACIB3 Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain AB307-0294) GN=fadB PE=3 SV=1 78 152 7.0E-06
sp|B0VLX4|FADB_ACIBS Fatty acid oxidation complex subunit alpha OS=Acinetobacter baumannii (strain SDF) GN=fadB PE=3 SV=1 78 152 7.0E-06
sp|Q6D2L7|FADJ_PECAS Fatty acid oxidation complex subunit alpha OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fadJ PE=3 SV=1 39 152 8.0E-06
sp|A6TC19|FADJ_KLEP7 Fatty acid oxidation complex subunit alpha OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=fadJ PE=3 SV=1 26 152 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0006631 fatty acid metabolic process Yes
GO:0044255 cellular lipid metabolic process No
GO:0032787 monocarboxylic acid metabolic process No
GO:0000166 nucleotide binding No
GO:0051287 NAD binding No
GO:0043167 ion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043168 anion binding No
GO:0006082 organic acid metabolic process No
GO:0043436 oxoacid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0006629 lipid metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0044237 cellular metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5873
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2049 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3693
Ophiocordyceps australis map64 (Brazil) OphauB2|696
Ophiocordyceps camponoti-floridani Ophcf2|03728
Ophiocordyceps camponoti-rufipedis Ophun1|4706
Ophiocordyceps kimflemingae Ophio5|4590

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2049
MAIRTVGVIGTGVIGSSWASLFLSHGLRVLVSDPAPNAEKQLDKFLKSRWPTMEKIGLGPGASLSNCTFVGGSMD
AHFAKLDFVQENAPEKVDIKTKLIGEIDAGTRPDVVIASSSSGIPSSQFISKCNKNPGRVLIGHPFNPPHLMPLV
EV*
Coding >OphauG2|2049
ATGGCTATCCGAACCGTGGGAGTGATTGGCACTGGTGTGATTGGTTCTTCATGGGCAAGCCTCTTTCTATCCCAC
GGGCTCCGAGTGTTGGTGTCGGATCCGGCTCCCAACGCCGAGAAGCAACTGGACAAGTTTCTCAAGAGTAGATGG
CCTACCATGGAGAAAATTGGGCTGGGGCCGGGTGCATCGCTGTCTAATTGTACCTTTGTCGGTGGTAGCATGGAT
GCTCATTTTGCCAAGCTTGATTTTGTCCAAGAGAACGCACCGGAAAAGGTAGACATTAAAACAAAGCTTATTGGC
GAAATCGACGCTGGCACGCGGCCCGACGTAGTGATAGCTTCCTCGTCGTCGGGTATCCCGAGCTCGCAGTTCATC
TCCAAGTGCAACAAGAATCCCGGCAGAGTCCTCATCGGCCATCCGTTTAACCCGCCGCATCTCATGCCGCTGGTC
GAGGTTTAA
Transcript >OphauG2|2049
ATGGCTATCCGAACCGTGGGAGTGATTGGCACTGGTGTGATTGGTTCTTCATGGGCAAGCCTCTTTCTATCCCAC
GGGCTCCGAGTGTTGGTGTCGGATCCGGCTCCCAACGCCGAGAAGCAACTGGACAAGTTTCTCAAGAGTAGATGG
CCTACCATGGAGAAAATTGGGCTGGGGCCGGGTGCATCGCTGTCTAATTGTACCTTTGTCGGTGGTAGCATGGAT
GCTCATTTTGCCAAGCTTGATTTTGTCCAAGAGAACGCACCGGAAAAGGTAGACATTAAAACAAAGCTTATTGGC
GAAATCGACGCTGGCACGCGGCCCGACGTAGTGATAGCTTCCTCGTCGTCGGGTATCCCGAGCTCGCAGTTCATC
TCCAAGTGCAACAAGAATCCCGGCAGAGTCCTCATCGGCCATCCGTTTAACCCGCCGCATCTCATGCCGCTGGTC
GAGGTTTAA
Gene >OphauG2|2049
ATGGCTATCCGAACCGTGGGAGTGATTGGCACTGGTGTGATTGGTTCTTCATGGGCAAGCCTCTTTCTATCCCAC
GGGCTCCGAGTGTTGGTGTCGGATCCGGCTCCCAACGCCGAGAAGCAACTGGACAAGTTTCTCAAGAGTAGATGG
CCTACCATGGAGAAAATTGGGCTGGGGCCGGGTGCATCGCTGTCTAATTGTACCTTTGTCGGTGGTAGCATGGAT
GCTCATTTTGCCAAGCTTGATTTTGTCCAAGAGGTAAGCCGTGGCCCATTGACTCAACAGCCCTTATGGCTAAGT
CTATGATACAGAACGCACCGGAAAAGGTAGACATTAAAACAAAGCTTATTGGCGAAATCGACGCTGGCACGCGGC
CCGACGTAGTGATAGCTTCCTCGTCGTCGGGTATCCCGAGCTCGCAGTTCATCTCCAAGTGCAACAAGAATCCCG
GCAGAGTCCTCATCGGCCATCCGTTTAACCCGCCGCATCTCATGCCGCTGGTCGAGGTTGTGCCTCATCCCAAGA
CGGACGAAACCTATATCGAGCAGGCCATGCACTTCTACCGGTCCCTCAACAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail