Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2044
Gene name
LocationContig_168:25828..26595
Strand-
Gene length (bp)767
Transcript length (bp)612
Coding sequence length (bp)612
Protein length (aa) 204

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 1 195 9.0E-27
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 21 194 2.0E-14
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 21 171 3.0E-13
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 3 178 1.0E-12
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 3 184 6.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 76 93 17
3 97 119 22
4 136 158 22
5 163 185 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2044
MLYATYFAIAVNLPQSLEKVYHWSSAAVGGGYVAIGVALIVGSIIGGRANDWRRARMIKATEIEHPEPETRLVDQ
IWGVLLCCAGTLMYGWFVDKAIHPAAVLVATFLAGFGMSWVFVATSAFLSECVPQQAAGAFALGNMLRNPAAAIA
AVILPTLIRKMGIGWFFTGMALLDFVLVGGAVIVLRIRSPHWRKQRQAKMAAR*
Coding >OphauG2|2044
ATGCTATACGCAACCTACTTTGCCATTGCCGTCAACCTCCCCCAGTCCCTCGAGAAAGTCTATCACTGGTCTAGT
GCAGCCGTTGGCGGCGGCTATGTTGCCATCGGAGTAGCCCTGATTGTCGGCTCCATCATTGGCGGCCGCGCCAAC
GACTGGCGAAGGGCTAGAATGATCAAGGCCACAGAGATTGAACACCCCGAACCTGAAACTCGCCTTGTCGACCAA
ATATGGGGCGTTTTGCTTTGTTGCGCTGGAACGCTCATGTATGGATGGTTCGTCGACAAGGCTATACACCCTGCT
GCTGTCCTGGTTGCCACGTTTCTAGCTGGCTTTGGCATGAGTTGGGTCTTTGTCGCCACCTCTGCCTTTTTATCC
GAATGCGTTCCACAACAAGCCGCCGGAGCTTTTGCCCTAGGAAACATGCTGCGAAACCCAGCTGCTGCCATTGCT
GCCGTCATCCTGCCTACCTTGATCCGCAAAATGGGCATCGGCTGGTTCTTTACCGGCATGGCTCTCTTGGACTTT
GTCTTGGTTGGCGGCGCCGTCATTGTCTTGCGCATACGGAGTCCGCATTGGAGGAAACAACGGCAGGCAAAGATG
GCTGCTAGATGA
Transcript >OphauG2|2044
ATGCTATACGCAACCTACTTTGCCATTGCCGTCAACCTCCCCCAGTCCCTCGAGAAAGTCTATCACTGGTCTAGT
GCAGCCGTTGGCGGCGGCTATGTTGCCATCGGAGTAGCCCTGATTGTCGGCTCCATCATTGGCGGCCGCGCCAAC
GACTGGCGAAGGGCTAGAATGATCAAGGCCACAGAGATTGAACACCCCGAACCTGAAACTCGCCTTGTCGACCAA
ATATGGGGCGTTTTGCTTTGTTGCGCTGGAACGCTCATGTATGGATGGTTCGTCGACAAGGCTATACACCCTGCT
GCTGTCCTGGTTGCCACGTTTCTAGCTGGCTTTGGCATGAGTTGGGTCTTTGTCGCCACCTCTGCCTTTTTATCC
GAATGCGTTCCACAACAAGCCGCCGGAGCTTTTGCCCTAGGAAACATGCTGCGAAACCCAGCTGCTGCCATTGCT
GCCGTCATCCTGCCTACCTTGATCCGCAAAATGGGCATCGGCTGGTTCTTTACCGGCATGGCTCTCTTGGACTTT
GTCTTGGTTGGCGGCGCCGTCATTGTCTTGCGCATACGGAGTCCGCATTGGAGGAAACAACGGCAGGCAAAGATG
GCTGCTAGATGA
Gene >OphauG2|2044
ATGCTATACGCAACCTACTTTGCCATTGCCGTCAACCTCCCCCAGTCCCTCGAGAAAGTCTATCACTGGTCTAGT
GCAGCCGTTGGCGGCGGCTATGTTGCCATCGGAGTAGCCCTGATTGTCGGCTCCATCATTGGCGGCCGCGCCAAC
GACTGGCGAAGGGCTAGAATGATCAAGGCCACAGAGATTGAACACCCCGAACCTGAAACTCGCCTTGTCGACCAA
ATATGGGGCGTTTTGCTTTGTTGCGCTGGAACGCTCATGTATGGATGGTTCGTCGACAAGGCTATACACCCTGCT
GCTGTCCTGGTTGCCACGTTTCTAGGTACGTTTTTTCTCGCCATTCTCATCTCAACACAGAGCGGCCAACACCTT
GTTTCCCCATCCTTGTTCACCCACTTACACTCTCGCCAGCTGGCTTTGGCATGAGTTGGGTCTTTGTCGCCACCT
CTGCCTTTTTATCCGAATGCGTTCCACAACAAGCCGCCGGAGCTTTTGCCCTAGGAAACATGCTGCGAAACCCAG
CTGCTGCCATTGCTGCCGTCATCCTGCCTACCTTGATCCGCAAAATGGGCATCGGCTGGTTCTTTACCGGCATGG
CTCTCTTGGACTTTGTCTTGGTTGGCGGCGCCGTCATTGGTTAGTTGCAAAAGCTCTTGCACGGGAGCGTCTTGA
CCACGAGGTGCTAATCACGTTTTGAAATAGTCTTGCGCATACGGAGTCCGCATTGGAGGAAACAACGGCAGGCAA
AGATGGCTGCTAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail