Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2043
Gene name
LocationContig_168:24321..25413
Strand+
Gene length (bp)1092
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03572 Peptidase_S41 Peptidase family S41 2.2E-06 19 195

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0008236 serine-type peptidase activity Yes
GO:0043170 macromolecule metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0019538 protein metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0017171 serine hydrolase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0140096 catalytic activity, acting on a protein No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup513
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2042
Ophiocordyceps australis 1348a (Ghana) OphauG2|2043 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|330
Ophiocordyceps camponoti-floridani Ophcf2|03497
Ophiocordyceps camponoti-rufipedis Ophun1|1443
Ophiocordyceps kimflemingae Ophio5|1795
Ophiocordyceps subramaniannii Hirsu2|2153
Ophiocordyceps subramaniannii Hirsu2|2505

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2043
MYISTFGSDDEEGKAFPVTYSDTLKEIIAKTKETGRTKMIIDISGNAGGSANRLYNMFRTFFPDKLPNEALRFRR
HPAAETMVEAFRVLNDTEATEFPSLALRAVAGPNLEGKFETPEELLGEQTLSQVKVSSAYNLDYNLISKKADPIA
GFGEAAKVQNAEFPIAAENMVIMGNGHCHSSCAEFVHFMTTNARIKTVAFGGQPKAGPMQIIGGVRGALVVPFEQ
ISALTGEALDIINDPQAKEVRREKIAMDAVPIPFQDLPIRLLGGSVNYESVFPTPDAQVPLQFETKNADCRLFYT
AENIMDPTTTWKAAKEVAWGGAKCVEGSTQNEAQQPKTQQPETQQPKKQQARGLMPRIRGSFR*
Coding >OphauG2|2043
ATGTACATTTCTACATTCGGGTCCGACGACGAAGAGGGCAAAGCTTTCCCAGTGACGTATTCAGATACGCTCAAG
GAAATTATTGCCAAAACCAAAGAGACGGGGCGCACAAAGATGATTATCGACATTTCGGGCAACGCGGGAGGCAGC
GCCAATAGGCTTTACAACATGTTTCGGACGTTTTTCCCCGACAAGTTGCCGAATGAGGCGCTTCGGTTTCGACGG
CACCCAGCAGCGGAAACCATGGTGGAGGCGTTTCGAGTGCTGAATGATACAGAAGCCACAGAGTTTCCGTCGCTG
GCGCTGCGGGCGGTTGCGGGGCCCAACTTGGAGGGGAAATTTGAGACGCCTGAGGAGCTCCTGGGGGAGCAGACG
CTATCACAGGTCAAGGTGTCATCGGCGTATAACCTGGACTATAACCTGATTTCGAAAAAGGCGGATCCGATTGCC
GGGTTTGGAGAAGCAGCCAAGGTGCAGAATGCAGAGTTTCCGATTGCAGCGGAAAACATGGTTATTATGGGCAAT
GGGCATTGCCACTCATCGTGTGCAGAGTTTGTGCATTTCATGACGACGAATGCGCGCATTAAGACGGTGGCGTTT
GGCGGACAGCCGAAAGCTGGGCCGATGCAGATTATAGGGGGTGTTCGAGGGGCGTTGGTGGTGCCGTTTGAACAG
ATATCAGCGCTGACGGGGGAAGCACTGGATATAATCAACGACCCGCAGGCAAAAGAGGTTAGAAGGGAAAAGATT
GCAATGGATGCGGTTCCGATTCCATTCCAGGATCTTCCGATACGGCTTCTGGGGGGGTCGGTCAACTACGAGAGT
GTATTTCCAACGCCCGATGCCCAGGTGCCGTTGCAGTTTGAGACCAAGAATGCCGACTGTCGCTTGTTTTACACG
GCGGAGAATATCATGGATCCAACGACGACTTGGAAGGCGGCCAAGGAGGTTGCTTGGGGCGGGGCAAAGTGTGTA
GAGGGCTCGACGCAAAATGAGGCGCAGCAGCCGAAAACGCAGCAGCCGGAAACGCAGCAGCCGAAAAAGCAGCAA
GCTCGGGGCTTGATGCCTAGAATACGTGGTTCTTTTAGGTAG
Transcript >OphauG2|2043
ATGTACATTTCTACATTCGGGTCCGACGACGAAGAGGGCAAAGCTTTCCCAGTGACGTATTCAGATACGCTCAAG
GAAATTATTGCCAAAACCAAAGAGACGGGGCGCACAAAGATGATTATCGACATTTCGGGCAACGCGGGAGGCAGC
GCCAATAGGCTTTACAACATGTTTCGGACGTTTTTCCCCGACAAGTTGCCGAATGAGGCGCTTCGGTTTCGACGG
CACCCAGCAGCGGAAACCATGGTGGAGGCGTTTCGAGTGCTGAATGATACAGAAGCCACAGAGTTTCCGTCGCTG
GCGCTGCGGGCGGTTGCGGGGCCCAACTTGGAGGGGAAATTTGAGACGCCTGAGGAGCTCCTGGGGGAGCAGACG
CTATCACAGGTCAAGGTGTCATCGGCGTATAACCTGGACTATAACCTGATTTCGAAAAAGGCGGATCCGATTGCC
GGGTTTGGAGAAGCAGCCAAGGTGCAGAATGCAGAGTTTCCGATTGCAGCGGAAAACATGGTTATTATGGGCAAT
GGGCATTGCCACTCATCGTGTGCAGAGTTTGTGCATTTCATGACGACGAATGCGCGCATTAAGACGGTGGCGTTT
GGCGGACAGCCGAAAGCTGGGCCGATGCAGATTATAGGGGGTGTTCGAGGGGCGTTGGTGGTGCCGTTTGAACAG
ATATCAGCGCTGACGGGGGAAGCACTGGATATAATCAACGACCCGCAGGCAAAAGAGGTTAGAAGGGAAAAGATT
GCAATGGATGCGGTTCCGATTCCATTCCAGGATCTTCCGATACGGCTTCTGGGGGGGTCGGTCAACTACGAGAGT
GTATTTCCAACGCCCGATGCCCAGGTGCCGTTGCAGTTTGAGACCAAGAATGCCGACTGTCGCTTGTTTTACACG
GCGGAGAATATCATGGATCCAACGACGACTTGGAAGGCGGCCAAGGAGGTTGCTTGGGGCGGGGCAAAGTGTGTA
GAGGGCTCGACGCAAAATGAGGCGCAGCAGCCGAAAACGCAGCAGCCGGAAACGCAGCAGCCGAAAAAGCAGCAA
GCTCGGGGCTTGATGCCTAGAATACGTGGTTCTTTTAGGTAG
Gene >OphauG2|2043
ATGTACATTTCTACATTCGGGTCCGACGACGAAGAGGGCAAAGCTTTCCCAGTGACGTATTCAGATACGCTCAAG
GAAATTATTGCCAAAACCAAAGAGACGGGGCGCACAAAGATGATTATCGACATTTCGGGCAACGCGGGAGGCAGC
GCCAATAGGCTTTACAACATGTTTCGGACGTTTTTCCCCGACAAGTTGCCGAATGAGGCGCTTCGGTTTCGACGG
CACCCAGCAGCGGAAACCATGGTGGAGGCGTTTCGAGTGCTGAATGATACAGAAGCCACAGAGTTTCCGTCGCTG
GCGCTGCGGGCGGTTGCGGGGCCCAACTTGGAGGGGAAATTTGAGACGCCTGAGGAGCTCCTGGGGGAGCAGACG
CTATCACAGGTCAAGGTGTCATCGGCGTATAACCTGGACTATAACCTGATTTCGAAAAAGGCGGATCCGATTGCC
GGGTTTGGAGAAGCAGCCAAGGTGCAGAATGCAGAGTTTCCGATTGCAGCGGAAAACATGGTTATTATGGGCAAT
GGGCATTGCCACTCATCGTGTGCAGAGTTTGTGCATTTCATGACGACGAATGCGCGCATTAAGACGGTGGCGTTT
GGCGGACAGCCGAAAGCTGGGCCGATGCAGATTATAGGGGGTGTTCGAGGGGCGTTGGTGGTGCCGTTTGAACAG
ATATCAGCGCTGACGGGGGAAGCACTGGATATAATCAACGACCCGCAGGCAAAAGAGGTTAGAAGGGAAAAGATT
GCAATGGATGCGGTTCCGATTCCATTCCAGGATCTTCCGATACGGCTTCTGGGGGGGTCGGTCAACTACGAGAGT
GTATTTCCAACGCCCGATGCCCAGGTGCCGTTGCAGTTTGAGACCAAGAATGCCGACTGTCGCTTGTTTTACACG
GCGGAGAATATCATGGATCCAACGACGACTTGGAAGGCGGCCAAGGAGGTTGCTTGGGGCGGGGCAAAGTGTGTA
GAGGGCTCGACGCAAAATGAGGCGCAGCAGCCGAAAACGCAGCAGCCGGAAACGCAGCAGCCGAAAAAGCAGCAA
GCTCGGGGCTTGATGCCTAGAATACGTGGTTCTTTTAGGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail