Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2038
Gene name
LocationContig_168:13124..14180
Strand+
Gene length (bp)1056
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08325 WLM WLM domain 3.5E-47 130 323

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94580|YQ77_SCHPO Ubiquitin and WLM domain-containing metalloprotease SPCC1442.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1442.07c PE=3 SV=1 127 254 3.0E-37
sp|P38838|WSS1_YEAST DNA-dependent metalloprotease WSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WSS1 PE=1 SV=1 141 273 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2038
MSTDAAGLLRLAISYRSHDYSLEFPQDATVQNLFKEIENAFDVPISNQKIFLPKGPLLKWPPKDPDMALHSLQDK
KLRLMGSGNAEVQAVNEMADRVARRATARSQAAGKVRAAPSRSSHAAEDARYTFQQVRPLTWLPHPERSEAMLLR
LKADPGIRSVMQRHRFTVALLTEMEPLSNTETTHQGTTRTFGLNRNKGEVIELRLRTDSHAGYRDYKTVRRTLCH
ELTHNVHGPHDAVFWELCRQIEREVEAADWKSGGQSVGGNTSRYVISGQVDLEPANQDEGGWTGGEFVLGQGKQG
GDKMRESGLSRREILAQAALTRQQREAEEERKACDAVDKGWKRCPGSHGGK*
Coding >OphauG2|2038
ATGTCCACCGACGCGGCAGGGCTGCTCAGATTGGCCATATCGTACCGCAGCCATGACTATAGCCTCGAATTCCCC
CAAGACGCAACGGTGCAAAACCTCTTCAAAGAGATTGAAAATGCCTTTGACGTGCCCATTAGCAACCAAAAGATT
TTCCTCCCCAAGGGCCCGTTGCTCAAGTGGCCGCCAAAGGACCCCGACATGGCTCTGCACAGTCTACAAGACAAG
AAGCTGAGGCTCATGGGCTCTGGCAATGCCGAGGTGCAGGCCGTCAACGAAATGGCTGATCGAGTGGCACGCCGC
GCCACGGCTCGAAGCCAGGCTGCAGGCAAAGTGCGCGCAGCACCCAGCCGGAGTAGCCACGCTGCTGAAGACGCT
CGCTACACCTTTCAACAAGTGCGCCCATTGACATGGTTGCCGCACCCAGAGCGCAGCGAGGCCATGTTGCTACGT
CTCAAGGCCGACCCGGGGATTCGAAGCGTCATGCAACGACACCGATTCACGGTAGCGCTGCTAACGGAAATGGAA
CCCTTATCCAACACGGAGACGACGCACCAAGGCACCACACGAACCTTTGGGCTCAACCGCAACAAGGGCGAGGTG
ATTGAGCTGCGGCTGCGAACAGACTCACATGCTGGCTATCGCGACTACAAGACGGTGCGGCGGACTCTTTGCCAC
GAGCTGACTCACAATGTCCACGGACCTCACGACGCAGTCTTTTGGGAACTGTGCCGCCAGATTGAGCGCGAGGTT
GAGGCGGCAGACTGGAAGAGCGGTGGGCAAAGCGTGGGCGGGAACACGTCTCGATATGTGATATCAGGCCAGGTT
GACCTGGAGCCTGCGAATCAAGACGAAGGAGGCTGGACGGGAGGCGAGTTTGTCCTGGGACAAGGCAAACAAGGC
GGCGACAAGATGAGGGAGAGTGGATTGAGCCGAAGAGAGATCCTGGCGCAGGCGGCGTTGACGAGACAGCAGAGA
GAAGCTGAGGAGGAGCGCAAGGCGTGCGATGCCGTGGACAAGGGGTGGAAACGGTGTCCAGGCAGCCATGGGGGC
AAATGA
Transcript >OphauG2|2038
ATGTCCACCGACGCGGCAGGGCTGCTCAGATTGGCCATATCGTACCGCAGCCATGACTATAGCCTCGAATTCCCC
CAAGACGCAACGGTGCAAAACCTCTTCAAAGAGATTGAAAATGCCTTTGACGTGCCCATTAGCAACCAAAAGATT
TTCCTCCCCAAGGGCCCGTTGCTCAAGTGGCCGCCAAAGGACCCCGACATGGCTCTGCACAGTCTACAAGACAAG
AAGCTGAGGCTCATGGGCTCTGGCAATGCCGAGGTGCAGGCCGTCAACGAAATGGCTGATCGAGTGGCACGCCGC
GCCACGGCTCGAAGCCAGGCTGCAGGCAAAGTGCGCGCAGCACCCAGCCGGAGTAGCCACGCTGCTGAAGACGCT
CGCTACACCTTTCAACAAGTGCGCCCATTGACATGGTTGCCGCACCCAGAGCGCAGCGAGGCCATGTTGCTACGT
CTCAAGGCCGACCCGGGGATTCGAAGCGTCATGCAACGACACCGATTCACGGTAGCGCTGCTAACGGAAATGGAA
CCCTTATCCAACACGGAGACGACGCACCAAGGCACCACACGAACCTTTGGGCTCAACCGCAACAAGGGCGAGGTG
ATTGAGCTGCGGCTGCGAACAGACTCACATGCTGGCTATCGCGACTACAAGACGGTGCGGCGGACTCTTTGCCAC
GAGCTGACTCACAATGTCCACGGACCTCACGACGCAGTCTTTTGGGAACTGTGCCGCCAGATTGAGCGCGAGGTT
GAGGCGGCAGACTGGAAGAGCGGTGGGCAAAGCGTGGGCGGGAACACGTCTCGATATGTGATATCAGGCCAGGTT
GACCTGGAGCCTGCGAATCAAGACGAAGGAGGCTGGACGGGAGGCGAGTTTGTCCTGGGACAAGGCAAACAAGGC
GGCGACAAGATGAGGGAGAGTGGATTGAGCCGAAGAGAGATCCTGGCGCAGGCGGCGTTGACGAGACAGCAGAGA
GAAGCTGAGGAGGAGCGCAAGGCGTGCGATGCCGTGGACAAGGGGTGGAAACGGTGTCCAGGCAGCCATGGGGGC
AAATGA
Gene >OphauG2|2038
ATGTCCACCGACGCGGCAGGGCTGCTCAGATTGGCCATATCGTACCGCAGCCATGACTATAGCCTCGAATTCCCC
CAAGACGCAACGGTGCAAAACCTCTTCAAAGAGATTGAAAATGCCTTTGACGTGCCCATTAGCAACCAAAAGATT
TTCCTCCCCAAGGGCCCGTTGCTCAAGTGGCCGCCAAAGGACCCCGACATGGCTCTGCACAGTCTACAAGACAAG
AAGCTGAGGCTCATGGGCTCTGGCAATGCCGAGGTGCAGGCCGTCAACGAAATGGCTGATCGAGTGGCACGCCGC
GCCACGGCTCGAAGCCAGGCTGCAGGCAAAGTGCGCGCAGCACCCAGCCGGAGTAGCCACGCTGCTGAAGACGCT
CGCTACACCTTTCAACAAGTGCGCCCATTGACATGGTTGCCGCACCCAGAGCGCAGCGAGGCCATGTTGCTACGT
CTCAAGGCCGACCCGGGGATTCGAAGCGTCATGCAACGACACCGATTCACGGTAGCGCTGCTAACGGAAATGGAA
CCCTTATCCAACACGGAGACGACGCACCAAGGCACCACACGAACCTTTGGGCTCAACCGCAACAAGGGCGAGGTG
ATTGAGCTGCGGCTGCGAACAGACTCACATGCTGGCTATCGCGACTACAAGACGGTGCGGCGGACTCTTTGCCAC
GAGCTGACTCACAATGTCCACGGACCTCACGACGCAGTCTTTTGGGAACTGTGCCGCCAGATTGAGCGCGAGGTT
GAGGCGGCAGACTGGAAGAGCGGTGGGCAAAGCGTGGGCGGGAACACGTCTCGATATGTGATATCAGGCCAGGTT
GACCTGGAGCCTGCGAATCAAGACGAAGGAGGCTGGACGGGAGGCGAGTTTGTCCTGGGACAAGGCAAACAAGGC
GGCGACAAGATGAGGGAGAGTGGATTGAGCCGAAGAGAGATCCTGGCGCAGGCGGCGTTGACGAGACAGCAGAGA
GAAGCTGAGGAGGAGCGCAAGGCGTGCGATGCCGTGGACAAGGGGTGGAAACGGTGTCCAGGCAGCCATGGGGGC
AAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail