Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2034
Gene name
LocationContig_168:7061..9341
Strand-
Gene length (bp)2280
Transcript length (bp)2280
Coding sequence length (bp)2280
Protein length (aa) 760

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07522 DRMBL DNA repair metallo-beta-lactamase 8.4E-37 575 708
PF12706 Lactamase_B_2 Beta-lactamase superfamily domain 1.1E-06 320 438

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10264|PSO2_SCHPO DNA cross-link repair protein pso2/snm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pso2 PE=3 SV=3 170 735 2.0E-114
sp|Q38961|SNM1_ARATH DNA cross-link repair protein SNM1 OS=Arabidopsis thaliana GN=SNM1 PE=2 SV=1 294 724 2.0E-74
sp|Q5QJC4|DCR1A_CHICK DNA cross-link repair 1A protein OS=Gallus gallus GN=DCLRE1A PE=1 SV=1 283 726 3.0E-72
sp|Q9JIC3|DCR1A_MOUSE DNA cross-link repair 1A protein OS=Mus musculus GN=Dclre1a PE=1 SV=2 286 726 2.0E-70
sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3 293 726 2.0E-69
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10264|PSO2_SCHPO DNA cross-link repair protein pso2/snm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pso2 PE=3 SV=3 170 735 2.0E-114
sp|Q38961|SNM1_ARATH DNA cross-link repair protein SNM1 OS=Arabidopsis thaliana GN=SNM1 PE=2 SV=1 294 724 2.0E-74
sp|Q5QJC4|DCR1A_CHICK DNA cross-link repair 1A protein OS=Gallus gallus GN=DCLRE1A PE=1 SV=1 283 726 3.0E-72
sp|Q9JIC3|DCR1A_MOUSE DNA cross-link repair 1A protein OS=Mus musculus GN=Dclre1a PE=1 SV=2 286 726 2.0E-70
sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3 293 726 2.0E-69
sp|P30620|PSO2_YEAST DNA cross-link repair protein PSO2/SNM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSO2 PE=1 SV=1 181 728 4.0E-55
sp|Q86KS1|DCR1_DICDI DNA cross-link repair 1 protein OS=Dictyostelium discoideum GN=dclre1 PE=3 SV=1 284 709 5.0E-47
sp|Q5QJC3|DCR1B_CHICK 5' exonuclease Apollo OS=Gallus gallus GN=DCLRE1B PE=2 SV=1 301 706 2.0E-31
sp|B0V2S2|DCR1B_DANRE 5' exonuclease Apollo OS=Danio rerio GN=dclre1b PE=2 SV=1 300 572 7.0E-25
sp|D2H8V8|DCR1B_AILME 5' exonuclease Apollo OS=Ailuropoda melanoleuca GN=DCLRE1B PE=3 SV=1 302 480 1.0E-24
sp|Q9H816|DCR1B_HUMAN 5' exonuclease Apollo OS=Homo sapiens GN=DCLRE1B PE=1 SV=1 302 509 4.0E-23
sp|Q4KLY6|DCR1B_RAT 5' exonuclease Apollo OS=Rattus norvegicus GN=Dclre1b PE=1 SV=2 301 509 7.0E-23
sp|Q8C7W7|DCR1B_MOUSE 5' exonuclease Apollo OS=Mus musculus GN=Dclre1b PE=1 SV=2 301 509 7.0E-23
sp|Q5QJC2|DCR1C_CHICK Protein artemis OS=Gallus gallus GN=DCLRE1C PE=2 SV=1 306 482 4.0E-12
sp|Q5XIX3|DCR1C_RAT Protein artemis OS=Rattus norvegicus GN=Dclre1c PE=1 SV=1 307 482 5.0E-12
sp|Q8K4J0|DCR1C_MOUSE Protein artemis OS=Mus musculus GN=Dclre1c PE=1 SV=2 307 482 6.0E-11
sp|Q5RGE5|DCR1C_DANRE Protein artemis OS=Danio rerio GN=dclre1c PE=2 SV=1 322 475 6.0E-11
sp|Q96SD1|DCR1C_HUMAN Protein artemis OS=Homo sapiens GN=DCLRE1C PE=1 SV=2 307 482 9.0E-11
sp|Q5R6Z9|DCR1C_PONAB Protein artemis OS=Pongo abelii GN=DCLRE1C PE=2 SV=1 307 482 1.0E-10
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3943
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2034 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|338
Ophiocordyceps camponoti-floridani Ophcf2|04369
Ophiocordyceps camponoti-rufipedis Ophun1|4551
Ophiocordyceps kimflemingae Ophio5|350
Ophiocordyceps subramaniannii Hirsu2|7846

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2034
MVATLKPAKRRPAAGIKPNTSILSFFRPAEKQEESLFVGTTPVPLCLEGGEARFNESNAPSKKRRLSSLNQEGLT
VTPRDPDQDETTNGVSDKNNPARSRLTAPALPFVLDSDSDDGPDESRASKRSTIDATDNVLADDARALPQEIDEA
EEDGQGEETRLRRFFAAEEGDVSLLDGVQETMIDTCPICDSSLYGYSSDNATRHVNMCLDSNGCESAPSPPQQVH
HVDSSLGSKRFIRAAIAKPAQANPLTMDGSSPDAKTAFSTLMSGNAEDSAWATAAAAEHASRGRPAYQRSCPFYK
TIPGFKICVDAFRYGAVQGCEAYFLSHFHSDHYMGLTANWAHGPIYCSRVTGGLVKQQLRTAAKWVVELEFDKLY
HVAGTDASVTMIAANHCPGSSLFLFEKSFETATGQRVRRILHCGDFRACPAQITHPLLKPDVVEAVTGKIKQQTI
NVCYLDTTYLNPRYSFPPQQDVIKACADLCASMSPDPDCKDEVWNQSSRATGDQAVSRFFHEPKTERLDGSEKKP
ARPRQRLLVICGTYSIGKERICVAIAKALGSKIFVTAAKAKIFRQLQDDELTCLLTSDPLEAQVHMQSLMEIRAE
TLQDYLNSYKPHFSRIVGLRPSGWTFRPSNGKTVGANTPPGSVPTQQLLHGKGWKTSFGYKDLVAQRGSTKEAMC
FGVPYSEHSSFRELAMFVMALRIEKVIPTVNVGSEQSRKRMKGWIDRWMAERRRGGLIEVLVEGRDGEGELWQGD
PGRGRGVWW*
Coding >OphauG2|2034
ATGGTTGCAACACTCAAGCCAGCCAAACGCCGCCCTGCTGCGGGCATCAAACCCAACACCAGTATTCTCAGCTTC
TTTCGCCCTGCCGAAAAACAAGAAGAGTCTCTCTTTGTTGGCACGACGCCCGTGCCCCTTTGCCTCGAGGGTGGC
GAAGCCCGCTTCAATGAGTCAAATGCGCCCTCCAAGAAACGACGCCTCAGCTCCCTCAACCAAGAGGGCTTGACC
GTCACCCCTAGAGACCCAGATCAAGATGAGACGACCAATGGAGTCTCGGACAAGAATAACCCTGCCCGGTCGCGA
CTGACTGCCCCTGCCCTGCCCTTTGTCTTGGACTCGGATTCAGATGATGGGCCAGACGAGTCTAGAGCGAGTAAA
CGCTCCACGATAGATGCCACCGATAATGTCTTGGCGGACGATGCACGCGCATTGCCTCAAGAGATAGATGAGGCA
GAAGAGGATGGCCAAGGCGAGGAAACGCGCCTGAGGCGATTCTTTGCAGCCGAGGAGGGTGACGTGTCTTTGCTC
GACGGCGTCCAAGAGACAATGATTGATACGTGTCCCATTTGTGACTCGAGTCTATATGGATACTCGTCTGACAAT
GCAACTCGCCATGTCAACATGTGTCTGGATAGCAATGGATGCGAATCTGCACCGAGTCCACCACAACAAGTCCAC
CATGTGGATTCCAGTCTTGGGAGCAAGAGGTTTATCCGAGCCGCCATTGCGAAGCCCGCCCAGGCCAATCCCCTG
ACAATGGATGGCAGCAGCCCAGATGCCAAAACTGCCTTTTCCACCCTCATGTCTGGCAATGCCGAGGACTCGGCC
TGGGCCACGGCTGCCGCGGCAGAACACGCATCTCGCGGCCGGCCCGCGTACCAAAGAAGTTGCCCGTTTTACAAG
ACTATACCTGGCTTCAAAATATGCGTCGATGCCTTTCGCTATGGCGCCGTGCAAGGTTGCGAAGCCTATTTTCTT
AGCCACTTTCACAGCGACCATTACATGGGTCTCACGGCCAACTGGGCCCATGGCCCAATCTATTGCAGCCGAGTC
ACGGGTGGTCTTGTCAAGCAGCAGCTCAGAACTGCCGCTAAATGGGTTGTTGAGCTTGAATTCGATAAGCTCTAC
CATGTTGCAGGAACCGACGCCTCGGTCACCATGATTGCGGCAAATCACTGCCCTGGGAGTAGCCTCTTTCTCTTT
GAAAAGTCTTTTGAAACAGCCACCGGCCAGCGAGTGCGGCGCATTTTGCACTGTGGTGATTTCCGCGCCTGCCCA
GCCCAAATTACCCACCCCTTGCTCAAGCCGGATGTTGTCGAGGCTGTGACTGGGAAAATCAAGCAACAGACCATT
AATGTGTGCTACCTTGACACGACATATCTTAATCCACGCTATTCTTTTCCTCCGCAGCAAGACGTCATCAAGGCT
TGCGCCGATTTGTGTGCCTCCATGTCTCCAGACCCTGACTGCAAAGACGAGGTTTGGAACCAGTCTAGCAGAGCG
ACGGGCGACCAAGCAGTGAGCAGATTTTTCCACGAGCCCAAGACGGAGCGTCTAGATGGCTCTGAGAAGAAGCCA
GCTAGGCCTCGGCAACGCCTGCTCGTTATATGCGGCACCTATTCCATCGGCAAAGAGCGTATATGCGTAGCCATT
GCCAAGGCTCTCGGATCAAAGATATTCGTCACTGCGGCCAAGGCCAAGATATTCCGACAGCTCCAAGACGACGAG
CTTACATGTTTGCTCACGTCGGATCCTCTCGAGGCCCAGGTGCACATGCAATCTCTCATGGAAATCCGGGCAGAG
ACGCTTCAGGATTACCTGAACAGCTACAAGCCTCATTTCAGCCGCATAGTGGGCCTCCGTCCCAGCGGCTGGACT
TTTCGCCCAAGCAACGGCAAGACTGTGGGCGCCAACACACCGCCGGGTAGCGTGCCGACGCAACAACTCTTGCAC
GGCAAGGGGTGGAAAACGAGCTTTGGCTACAAGGACTTGGTGGCGCAGAGAGGCAGCACCAAGGAAGCCATGTGT
TTTGGAGTGCCCTACTCGGAGCACAGCAGTTTTCGAGAATTGGCCATGTTTGTAATGGCGCTGCGCATTGAAAAG
GTGATTCCTACGGTAAACGTGGGCAGCGAGCAGTCGAGGAAGAGAATGAAGGGCTGGATTGACCGCTGGATGGCA
GAGAGGAGGCGCGGCGGGCTCATTGAGGTGTTGGTGGAGGGGAGGGATGGAGAGGGAGAGTTGTGGCAAGGGGAT
CCAGGACGAGGGCGGGGTGTCTGGTGGTGA
Transcript >OphauG2|2034
ATGGTTGCAACACTCAAGCCAGCCAAACGCCGCCCTGCTGCGGGCATCAAACCCAACACCAGTATTCTCAGCTTC
TTTCGCCCTGCCGAAAAACAAGAAGAGTCTCTCTTTGTTGGCACGACGCCCGTGCCCCTTTGCCTCGAGGGTGGC
GAAGCCCGCTTCAATGAGTCAAATGCGCCCTCCAAGAAACGACGCCTCAGCTCCCTCAACCAAGAGGGCTTGACC
GTCACCCCTAGAGACCCAGATCAAGATGAGACGACCAATGGAGTCTCGGACAAGAATAACCCTGCCCGGTCGCGA
CTGACTGCCCCTGCCCTGCCCTTTGTCTTGGACTCGGATTCAGATGATGGGCCAGACGAGTCTAGAGCGAGTAAA
CGCTCCACGATAGATGCCACCGATAATGTCTTGGCGGACGATGCACGCGCATTGCCTCAAGAGATAGATGAGGCA
GAAGAGGATGGCCAAGGCGAGGAAACGCGCCTGAGGCGATTCTTTGCAGCCGAGGAGGGTGACGTGTCTTTGCTC
GACGGCGTCCAAGAGACAATGATTGATACGTGTCCCATTTGTGACTCGAGTCTATATGGATACTCGTCTGACAAT
GCAACTCGCCATGTCAACATGTGTCTGGATAGCAATGGATGCGAATCTGCACCGAGTCCACCACAACAAGTCCAC
CATGTGGATTCCAGTCTTGGGAGCAAGAGGTTTATCCGAGCCGCCATTGCGAAGCCCGCCCAGGCCAATCCCCTG
ACAATGGATGGCAGCAGCCCAGATGCCAAAACTGCCTTTTCCACCCTCATGTCTGGCAATGCCGAGGACTCGGCC
TGGGCCACGGCTGCCGCGGCAGAACACGCATCTCGCGGCCGGCCCGCGTACCAAAGAAGTTGCCCGTTTTACAAG
ACTATACCTGGCTTCAAAATATGCGTCGATGCCTTTCGCTATGGCGCCGTGCAAGGTTGCGAAGCCTATTTTCTT
AGCCACTTTCACAGCGACCATTACATGGGTCTCACGGCCAACTGGGCCCATGGCCCAATCTATTGCAGCCGAGTC
ACGGGTGGTCTTGTCAAGCAGCAGCTCAGAACTGCCGCTAAATGGGTTGTTGAGCTTGAATTCGATAAGCTCTAC
CATGTTGCAGGAACCGACGCCTCGGTCACCATGATTGCGGCAAATCACTGCCCTGGGAGTAGCCTCTTTCTCTTT
GAAAAGTCTTTTGAAACAGCCACCGGCCAGCGAGTGCGGCGCATTTTGCACTGTGGTGATTTCCGCGCCTGCCCA
GCCCAAATTACCCACCCCTTGCTCAAGCCGGATGTTGTCGAGGCTGTGACTGGGAAAATCAAGCAACAGACCATT
AATGTGTGCTACCTTGACACGACATATCTTAATCCACGCTATTCTTTTCCTCCGCAGCAAGACGTCATCAAGGCT
TGCGCCGATTTGTGTGCCTCCATGTCTCCAGACCCTGACTGCAAAGACGAGGTTTGGAACCAGTCTAGCAGAGCG
ACGGGCGACCAAGCAGTGAGCAGATTTTTCCACGAGCCCAAGACGGAGCGTCTAGATGGCTCTGAGAAGAAGCCA
GCTAGGCCTCGGCAACGCCTGCTCGTTATATGCGGCACCTATTCCATCGGCAAAGAGCGTATATGCGTAGCCATT
GCCAAGGCTCTCGGATCAAAGATATTCGTCACTGCGGCCAAGGCCAAGATATTCCGACAGCTCCAAGACGACGAG
CTTACATGTTTGCTCACGTCGGATCCTCTCGAGGCCCAGGTGCACATGCAATCTCTCATGGAAATCCGGGCAGAG
ACGCTTCAGGATTACCTGAACAGCTACAAGCCTCATTTCAGCCGCATAGTGGGCCTCCGTCCCAGCGGCTGGACT
TTTCGCCCAAGCAACGGCAAGACTGTGGGCGCCAACACACCGCCGGGTAGCGTGCCGACGCAACAACTCTTGCAC
GGCAAGGGGTGGAAAACGAGCTTTGGCTACAAGGACTTGGTGGCGCAGAGAGGCAGCACCAAGGAAGCCATGTGT
TTTGGAGTGCCCTACTCGGAGCACAGCAGTTTTCGAGAATTGGCCATGTTTGTAATGGCGCTGCGCATTGAAAAG
GTGATTCCTACGGTAAACGTGGGCAGCGAGCAGTCGAGGAAGAGAATGAAGGGCTGGATTGACCGCTGGATGGCA
GAGAGGAGGCGCGGCGGGCTCATTGAGGTGTTGGTGGAGGGGAGGGATGGAGAGGGAGAGTTGTGGCAAGGGGAT
CCAGGACGAGGGCGGGGTGTCTGGTGGTGA
Gene >OphauG2|2034
ATGGTTGCAACACTCAAGCCAGCCAAACGCCGCCCTGCTGCGGGCATCAAACCCAACACCAGTATTCTCAGCTTC
TTTCGCCCTGCCGAAAAACAAGAAGAGTCTCTCTTTGTTGGCACGACGCCCGTGCCCCTTTGCCTCGAGGGTGGC
GAAGCCCGCTTCAATGAGTCAAATGCGCCCTCCAAGAAACGACGCCTCAGCTCCCTCAACCAAGAGGGCTTGACC
GTCACCCCTAGAGACCCAGATCAAGATGAGACGACCAATGGAGTCTCGGACAAGAATAACCCTGCCCGGTCGCGA
CTGACTGCCCCTGCCCTGCCCTTTGTCTTGGACTCGGATTCAGATGATGGGCCAGACGAGTCTAGAGCGAGTAAA
CGCTCCACGATAGATGCCACCGATAATGTCTTGGCGGACGATGCACGCGCATTGCCTCAAGAGATAGATGAGGCA
GAAGAGGATGGCCAAGGCGAGGAAACGCGCCTGAGGCGATTCTTTGCAGCCGAGGAGGGTGACGTGTCTTTGCTC
GACGGCGTCCAAGAGACAATGATTGATACGTGTCCCATTTGTGACTCGAGTCTATATGGATACTCGTCTGACAAT
GCAACTCGCCATGTCAACATGTGTCTGGATAGCAATGGATGCGAATCTGCACCGAGTCCACCACAACAAGTCCAC
CATGTGGATTCCAGTCTTGGGAGCAAGAGGTTTATCCGAGCCGCCATTGCGAAGCCCGCCCAGGCCAATCCCCTG
ACAATGGATGGCAGCAGCCCAGATGCCAAAACTGCCTTTTCCACCCTCATGTCTGGCAATGCCGAGGACTCGGCC
TGGGCCACGGCTGCCGCGGCAGAACACGCATCTCGCGGCCGGCCCGCGTACCAAAGAAGTTGCCCGTTTTACAAG
ACTATACCTGGCTTCAAAATATGCGTCGATGCCTTTCGCTATGGCGCCGTGCAAGGTTGCGAAGCCTATTTTCTT
AGCCACTTTCACAGCGACCATTACATGGGTCTCACGGCCAACTGGGCCCATGGCCCAATCTATTGCAGCCGAGTC
ACGGGTGGTCTTGTCAAGCAGCAGCTCAGAACTGCCGCTAAATGGGTTGTTGAGCTTGAATTCGATAAGCTCTAC
CATGTTGCAGGAACCGACGCCTCGGTCACCATGATTGCGGCAAATCACTGCCCTGGGAGTAGCCTCTTTCTCTTT
GAAAAGTCTTTTGAAACAGCCACCGGCCAGCGAGTGCGGCGCATTTTGCACTGTGGTGATTTCCGCGCCTGCCCA
GCCCAAATTACCCACCCCTTGCTCAAGCCGGATGTTGTCGAGGCTGTGACTGGGAAAATCAAGCAACAGACCATT
AATGTGTGCTACCTTGACACGACATATCTTAATCCACGCTATTCTTTTCCTCCGCAGCAAGACGTCATCAAGGCT
TGCGCCGATTTGTGTGCCTCCATGTCTCCAGACCCTGACTGCAAAGACGAGGTTTGGAACCAGTCTAGCAGAGCG
ACGGGCGACCAAGCAGTGAGCAGATTTTTCCACGAGCCCAAGACGGAGCGTCTAGATGGCTCTGAGAAGAAGCCA
GCTAGGCCTCGGCAACGCCTGCTCGTTATATGCGGCACCTATTCCATCGGCAAAGAGCGTATATGCGTAGCCATT
GCCAAGGCTCTCGGATCAAAGATATTCGTCACTGCGGCCAAGGCCAAGATATTCCGACAGCTCCAAGACGACGAG
CTTACATGTTTGCTCACGTCGGATCCTCTCGAGGCCCAGGTGCACATGCAATCTCTCATGGAAATCCGGGCAGAG
ACGCTTCAGGATTACCTGAACAGCTACAAGCCTCATTTCAGCCGCATAGTGGGCCTCCGTCCCAGCGGCTGGACT
TTTCGCCCAAGCAACGGCAAGACTGTGGGCGCCAACACACCGCCGGGTAGCGTGCCGACGCAACAACTCTTGCAC
GGCAAGGGGTGGAAAACGAGCTTTGGCTACAAGGACTTGGTGGCGCAGAGAGGCAGCACCAAGGAAGCCATGTGT
TTTGGAGTGCCCTACTCGGAGCACAGCAGTTTTCGAGAATTGGCCATGTTTGTAATGGCGCTGCGCATTGAAAAG
GTGATTCCTACGGTAAACGTGGGCAGCGAGCAGTCGAGGAAGAGAATGAAGGGCTGGATTGACCGCTGGATGGCA
GAGAGGAGGCGCGGCGGGCTCATTGAGGTGTTGGTGGAGGGGAGGGATGGAGAGGGAGAGTTGTGGCAAGGGGAT
CCAGGACGAGGGCGGGGTGTCTGGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail