Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2032
Gene name
LocationContig_168:4783..5269
Strand+
Gene length (bp)486
Transcript length (bp)345
Coding sequence length (bp)345
Protein length (aa) 115

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P52751|MPG1_MAGO7 Hydrophobin-like protein MPG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MPG1 PE=3 SV=1 32 100 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2032
MYAFKLFALALAAVTVSAVPADMKKHHDVPNTWNWAKKECSGSHNVSCCNKNDSDGGAGGIPIDLTLTCTNIPIG
ILAILLPPPSWCDTTVCCDTTQNGLSRLIHDLKVDMGLG*
Coding >OphauG2|2032
ATGTACGCCTTCAAGCTTTTCGCGCTTGCCCTTGCGGCTGTGACTGTTTCGGCGGTTCCGGCGGATATGAAGAAG
CATCATGACGTGCCGAATACTTGGAACTGGGCCAAGAAGGAATGCTCGGGCAGCCACAATGTGTCGTGCTGTAAC
AAGAACGATTCGGATGGAGGGGCTGGTGGCATCCCCATCGATTTGACTCTTACTTGCACCAATATTCCCATTGGG
ATTCTCGCCATCCTTCTTCCTCCCCCGAGTTGGTGTGATACCACTGTCTGCTGCGACACTACTCAAAACGGTCTC
AGTAGGTTGATTCACGATCTCAAGGTCGACATGGGACTAGGCTAA
Transcript >OphauG2|2032
ATGTACGCCTTCAAGCTTTTCGCGCTTGCCCTTGCGGCTGTGACTGTTTCGGCGGTTCCGGCGGATATGAAGAAG
CATCATGACGTGCCGAATACTTGGAACTGGGCCAAGAAGGAATGCTCGGGCAGCCACAATGTGTCGTGCTGTAAC
AAGAACGATTCGGATGGAGGGGCTGGTGGCATCCCCATCGATTTGACTCTTACTTGCACCAATATTCCCATTGGG
ATTCTCGCCATCCTTCTTCCTCCCCCGAGTTGGTGTGATACCACTGTCTGCTGCGACACTACTCAAAACGGTCTC
AGTAGGTTGATTCACGATCTCAAGGTCGACATGGGACTAGGCTAA
Gene >OphauG2|2032
ATGTACGCCTTCAAGCTTTTCGCGCTTGCCCTTGCGGCTGTGACTGTTTCGGCGGTTCCGGCGGATATGAAGAAG
CATCATGACGTGCCGAATACTTGGAACTGGGCCAAGAAGGAATGCTCGGGCAGCCACAATGTGTCGTGCTGTAAC
AAGAACGATTCGGATGGAGGGGCTGGTGGCATCCCCATCGATTTGACTCTTACTTGTAAGTTGGGGGGAGGATAA
ATATCAAAGGAGATGACGATGGGTGAAGCAGATGAGCTAATTGGTTTTGCAGGCACCAATATTCCCATTGGGGTA
GGGTCCCGGCTTGTTTTATATACTGGGGATTCTGAAGCAGGGCTTGGAAGCTAACATGGAATATAGATTCTCGCC
ATCCTTCTTCCTCCCCCGAGTTGGTGTGATACCACTGTCTGCTGCGACACTACTCAAAACGGTCTCAGTAGGTTG
ATTCACGATCTCAAGGTCGACATGGGACTAGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail