Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2028
Gene name
LocationContig_1678:65..1169
Strand+
Gene length (bp)1104
Transcript length (bp)921
Coding sequence length (bp)921
Protein length (aa) 307

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04437 RINT1_TIP1 RINT-1 / TIP-1 family 5.2E-82 1 297

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Yes
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Yes
GO:0070939 Dsl1/NZR complex Yes
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0006810 transport No
GO:0032991 protein-containing complex No
GO:0051234 establishment of localization No
GO:0051649 establishment of localization in cell No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0099023 vesicle tethering complex No
GO:0140534 endoplasmic reticulum protein-containing complex No
GO:0005575 cellular_component No
GO:0009987 cellular process No
GO:0048193 Golgi vesicle transport No
GO:0016192 vesicle-mediated transport No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7647
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2028 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6261

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2028
MTSTIGRTLHGATKDELAAVEGIGALETLCKVIGSADHVANTLIEWSDEEFFAQLWQELQARNAQGTSQDGSTGI
LHQEGIQGRVPNGAGRDSKDSGIFDETAAAYIGRRKAAEKLLVGALADSHTKAFRAYMAHVQWTTIGDAAIMDDA
SQMSITPELDEPLRTLKSNFEFLSKALSAASLRRVWREALDKLQDILWNGVLLRQTFTTLGAAQFAHDGAAIFSL
IEHYIPGASAALNALRQGLQLVSLPAEPTNGISLKEASDRAFASNQEARGMLQDLGLGALTPMNARHILERRIEN
SENVGW*
Coding >OphauG2|2028
ATGACCTCAACGATTGGCCGGACACTGCACGGCGCGACCAAGGACGAACTGGCTGCCGTTGAAGGCATCGGGGCC
CTGGAAACGCTGTGTAAAGTGATTGGCAGTGCAGACCATGTGGCAAATACGCTGATTGAATGGAGCGACGAAGAG
TTCTTTGCACAGCTATGGCAAGAGCTCCAAGCGCGTAATGCTCAAGGTACTTCTCAAGACGGATCTACTGGAATT
CTCCACCAAGAGGGTATCCAGGGCCGTGTTCCCAATGGGGCGGGACGAGACAGCAAAGATAGCGGCATCTTTGAC
GAGACCGCGGCCGCCTACATTGGGCGCCGCAAGGCTGCTGAAAAGCTTCTCGTTGGCGCATTAGCAGACTCTCAC
ACCAAAGCCTTTCGCGCATACATGGCCCATGTCCAATGGACGACAATTGGCGATGCAGCCATCATGGACGACGCG
TCCCAAATGTCAATAACACCAGAGCTCGACGAACCTTTGCGAACACTCAAGAGCAACTTTGAGTTTTTGTCCAAA
GCTCTCTCCGCGGCGTCGCTACGTCGCGTCTGGCGCGAGGCCCTTGACAAGCTTCAGGACATACTGTGGAACGGT
GTGCTCTTGCGGCAAACATTTACGACGCTAGGGGCTGCGCAGTTTGCTCATGATGGCGCAGCCATCTTTTCGCTT
ATTGAGCACTATATCCCTGGTGCTTCAGCTGCTCTCAATGCCCTGCGCCAGGGTTTACAACTCGTTAGCCTGCCG
GCCGAACCTACCAATGGCATCTCTTTAAAGGAGGCCAGTGACCGGGCGTTTGCGAGCAACCAAGAGGCTCGTGGG
ATGCTTCAAGACTTGGGTCTTGGCGCATTGACGCCCATGAACGCAAGACATATTTTAGAGAGACGTATAGAGAAC
AGCGAAAACGTGGGCTGGTGA
Transcript >OphauG2|2028
ATGACCTCAACGATTGGCCGGACACTGCACGGCGCGACCAAGGACGAACTGGCTGCCGTTGAAGGCATCGGGGCC
CTGGAAACGCTGTGTAAAGTGATTGGCAGTGCAGACCATGTGGCAAATACGCTGATTGAATGGAGCGACGAAGAG
TTCTTTGCACAGCTATGGCAAGAGCTCCAAGCGCGTAATGCTCAAGGTACTTCTCAAGACGGATCTACTGGAATT
CTCCACCAAGAGGGTATCCAGGGCCGTGTTCCCAATGGGGCGGGACGAGACAGCAAAGATAGCGGCATCTTTGAC
GAGACCGCGGCCGCCTACATTGGGCGCCGCAAGGCTGCTGAAAAGCTTCTCGTTGGCGCATTAGCAGACTCTCAC
ACCAAAGCCTTTCGCGCATACATGGCCCATGTCCAATGGACGACAATTGGCGATGCAGCCATCATGGACGACGCG
TCCCAAATGTCAATAACACCAGAGCTCGACGAACCTTTGCGAACACTCAAGAGCAACTTTGAGTTTTTGTCCAAA
GCTCTCTCCGCGGCGTCGCTACGTCGCGTCTGGCGCGAGGCCCTTGACAAGCTTCAGGACATACTGTGGAACGGT
GTGCTCTTGCGGCAAACATTTACGACGCTAGGGGCTGCGCAGTTTGCTCATGATGGCGCAGCCATCTTTTCGCTT
ATTGAGCACTATATCCCTGGTGCTTCAGCTGCTCTCAATGCCCTGCGCCAGGGTTTACAACTCGTTAGCCTGCCG
GCCGAACCTACCAATGGCATCTCTTTAAAGGAGGCCAGTGACCGGGCGTTTGCGAGCAACCAAGAGGCTCGTGGG
ATGCTTCAAGACTTGGGTCTTGGCGCATTGACGCCCATGAACGCAAGACATATTTTAGAGAGACGTATAGAGAAC
AGCGAAAACGTGGGCTGGTGA
Gene >OphauG2|2028
ATGACCTCAACGATTGGCCGGACACTGCACGGCGCGACCAAGGACGAACTGGCTGCCGTTGAAGGCATCGGGGCC
CTGGAAACGCTGTGTAAAGTGATTGGCAGTGCAGACCATGTGGCAAATACGCTGATTGAATGGAGCGACGAAGAG
GTGAATGGAGCTCCGCCGTGCCTCGACTAGTTTTCCTCGACTAGTTTGCCCCTGTTTGGAACTCTCAGCTAACAA
CCTGCCAACAGTTCTTTGCACAGCTATGGCAAGAGCTCCAAGCGCGTAATGCTCAAGGTACTTCTCAAGACGGAT
CTACTGGAATTCTCCACCAAGAGGGTATCCAGGGCCGTGTTCCCAATGGGGCGGGACGAGACAGCAAAGATAGCG
GCATCTTTGACGAGACCGCGGCCGCCTACATTGGGCGCCGCAAGGCTGCTGAAAAGCTTCTCGTTGGCGCATTAG
CAGACTCTCACACCAAAGCCTTTCGCGCATACATGGCCCATGTCCAATGGACGACAATTGGCGATGCAGCCATCA
TGGGTAAGCCGGCTCTTCTTTTTTTTTTTTTGGAGCGGGGGGTTTACTTTTTTCGTCAGTGCCAGACATGGACTG
CCCGACTGACTCTTACTTCTTCAAGACGACGCGTCCCAAATGTCAATAACACCAGAGCTCGACGAACCTTTGCGA
ACACTCAAGAGCAACTTTGAGTTTTTGTCCAAAGCTCTCTCCGCGGCGTCGCTACGTCGCGTCTGGCGCGAGGCC
CTTGACAAGCTTCAGGACATACTGTGGAACGGTGTGCTCTTGCGGCAAACATTTACGACGCTAGGGGCTGCGCAG
TTTGCTCATGATGGCGCAGCCATCTTTTCGCTTATTGAGCACTATATCCCTGGTGCTTCAGCTGCTCTCAATGCC
CTGCGCCAGGGTTTACAACTCGTTAGCCTGCCGGCCGAACCTACCAATGGCATCTCTTTAAAGGAGGCCAGTGAC
CGGGCGTTTGCGAGCAACCAAGAGGCTCGTGGGATGCTTCAAGACTTGGGTCTTGGCGCATTGACGCCCATGAAC
GCAAGACATATTTTAGAGAGACGTATAGAGAACAGCGAAAACGTGGGCTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail