Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|202
Gene name
LocationContig_1039:923..3536
Strand+
Gene length (bp)2613
Transcript length (bp)2553
Coding sequence length (bp)2553
Protein length (aa) 851

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02146 SIR2 Sir2 family 5.1E-07 32 57
PF02146 SIR2 Sir2 family 3.8E-09 250 306
PF02146 SIR2 Sir2 family 1.5E-11 395 498

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 228 556 3.0E-44
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 394 557 2.0E-33
sp|P53688|HST4_YEAST NAD-dependent histone deacetylase HST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST4 PE=1 SV=1 397 541 1.0E-22
sp|Q5BE04|HST4_EMENI NAD-dependent protein deacetylase hst4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1226 PE=3 SV=1 397 549 1.0E-22
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 399 583 5.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 228 556 3.0E-44
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 394 557 2.0E-33
sp|P53688|HST4_YEAST NAD-dependent histone deacetylase HST4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST4 PE=1 SV=1 397 541 1.0E-22
sp|Q5BE04|HST4_EMENI NAD-dependent protein deacetylase hst4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN1226 PE=3 SV=1 397 549 1.0E-22
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 399 583 5.0E-21
sp|P53687|HST3_YEAST NAD-dependent histone deacetylase HST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HST3 PE=1 SV=1 234 301 3.0E-16
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 216 305 4.0E-10
sp|Q9UR39|HST4_SCHPO NAD-dependent protein deacetylase hst4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hst4 PE=2 SV=1 14 59 2.0E-07
sp|Q5A1W9|HST3_CANAL NAD-dependent histone deacetylase HST3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HST3 PE=3 SV=1 14 57 1.0E-06
sp|Q81BT4|NPD_BACCR NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cobB PE=3 SV=1 13 52 1.0E-06
sp|Q735N7|NPD_BACC1 NAD-dependent protein deacetylase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cobB PE=3 SV=1 13 52 2.0E-06
sp|Q6FWI7|SIR2_CANGA NAD-dependent histone deacetylase SIR2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SIR2 PE=3 SV=1 14 55 2.0E-06
sp|Q757M7|SIR2_ASHGO NAD-dependent histone deacetylase SIR2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SIR2 PE=3 SV=1 14 54 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0070403 NAD+ binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0051287 NAD binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|202
MPTVHALPQSHDHLSHVASSLLKARKVVVITGAGISTNSGIPDFRSDNGLYSLIQAQFEHVARQPRQPDLHVRGN
VALPPSSVSRVAPDADASLDTIYVKSPSIDANDAAQRDLDSFDVNSSPPACPHPATSPLSSPPPSSIFNSPTTHA
YKHRKPSIDVILPLSSSPPSSPSPSGIASPSLPSSTSSLTGHGSSRQDSPYPEQNQTNNASKPLDSSQTSTSSRN
SLPSVNMKGRDLFDAAIWSDPLRTSVFYTFATSLRQKVKTAEPTDSHRFIGHLRDRGKLVRCYTQNIDQIEEKVG
LKTCLQAGPGNRGRFSRRSAANSRQLDKMVPDTSLCSNEQATLDDANSTEPSSSPDSESGEAGQATLLNPGFEPD
ASESQDSFQPQKLPGSHGVECVFLHGSLERLRCFRCAQLCSWDDEREAETLTGQQPECPHCAGATAAREEKGKRA
LGVGKLRPDIVLYGEEHPNSHLISPIITHDLSLHPDMLLILGTSLRVHGLKVMVREFAKAVHSKGGKVVFVNFTK
PPSWGDMIDYWIQWDCDAWVADLQSRVPQLWKPHSTSHKGKTQGTSQGTSTPGNRPAKTKKPPVYPAAVRDTKAT
GAYWTCKILQDLHRITGTRFLLPPKPPCSDKRAGEVSEDLETEALSSDLAPQAPPQKLETKKSKPRPRQAKKIIS
NITKRKKQPPSTLNPNRERPRQTKQKQKAPSMALTGMEIPLSSILNAVKENPRIRKRKKIDGEEVPAPCIGRKRG
VNGQNHDQSIPPELKLAPFQSPAAPETTLPLKYGKPEPLEPRSPPSGPLMSLSPNLRSFGSSTYSSLYSDCQPVW
GTQEAIMPALKPTQLGLPLPQLQRA*
Coding >OphauG2|202
ATGCCAACTGTGCACGCCTTGCCTCAATCCCACGACCATCTTAGCCACGTCGCCAGCTCTCTGCTCAAGGCGCGC
AAGGTTGTCGTCATCACGGGCGCCGGCATCAGCACCAATTCGGGCATTCCGGACTTTCGCTCCGACAATGGCCTT
TACTCCCTCATACAGGCCCAATTCGAGCATGTCGCGCGTCAACCGCGTCAGCCAGACCTACATGTCCGTGGAAAT
GTCGCCCTGCCGCCCTCGTCTGTGTCCCGCGTCGCACCCGATGCCGACGCGTCTTTGGACACCATTTACGTCAAG
TCGCCCTCTATAGACGCCAATGACGCTGCACAAAGGGACCTCGATTCGTTTGACGTGAATTCTTCACCCCCTGCT
TGTCCCCACCCTGCAACCTCGCCGCTCTCTTCTCCCCCCCCTAGCAGCATCTTCAACTCGCCCACCACCCATGCT
TACAAACACCGCAAACCCTCGATTGACGTGATTCTGCCCTTGAGCTCATCTCCTCCATCATCACCCTCCCCGTCT
GGAATTGCATCTCCCTCTCTCCCATCCTCGACAAGCTCCCTCACCGGCCATGGCTCAAGCAGACAGGACAGTCCA
TATCCAGAACAAAACCAGACCAACAATGCATCAAAGCCATTGGATTCGTCCCAAACCTCGACTTCGAGCAGAAAC
TCACTTCCCAGCGTCAACATGAAAGGCAGGGATCTCTTTGACGCTGCTATTTGGTCGGATCCTCTTCGAACTTCG
GTTTTCTACACATTTGCTACTTCTCTTCGACAAAAGGTCAAGACGGCAGAGCCCACCGACTCTCATCGATTCATT
GGCCACCTTAGAGATCGTGGGAAGCTGGTTCGTTGCTACACGCAAAACATTGACCAAATCGAAGAAAAAGTGGGC
TTGAAAACCTGTCTGCAAGCTGGACCTGGCAACCGGGGGCGCTTTTCTCGCCGCTCAGCTGCAAACTCAAGGCAA
CTTGACAAGATGGTGCCAGACACGTCACTATGCTCCAATGAACAAGCAACTTTGGATGATGCAAATAGCACCGAG
CCCAGCAGTTCACCTGACAGTGAATCAGGTGAAGCAGGACAAGCAACTCTTTTGAACCCAGGTTTCGAGCCAGAC
GCTTCCGAGTCTCAGGATAGTTTTCAGCCACAAAAGCTGCCAGGGTCGCATGGCGTTGAATGCGTCTTTCTGCAT
GGGTCCCTCGAGAGATTAAGATGCTTTCGCTGTGCTCAGCTCTGCTCGTGGGATGATGAGCGCGAGGCCGAGACG
CTTACTGGCCAGCAGCCCGAGTGTCCGCACTGCGCTGGTGCCACGGCAGCGCGAGAAGAAAAGGGAAAACGTGCT
CTGGGGGTTGGAAAACTACGACCAGACATTGTACTGTATGGCGAGGAGCACCCCAACTCACATCTCATCAGCCCC
ATCATTACCCATGACCTGAGTCTACATCCCGACATGCTCCTTATTCTCGGCACAAGCTTGAGGGTCCACGGACTA
AAAGTAATGGTTCGCGAGTTTGCAAAGGCTGTCCACAGCAAAGGGGGAAAGGTGGTCTTTGTCAACTTTACCAAG
CCTCCCTCGTGGGGAGACATGATTGACTACTGGATTCAGTGGGATTGCGACGCTTGGGTAGCAGACTTGCAAAGC
AGAGTCCCGCAACTCTGGAAGCCGCATAGCACGTCTCACAAGGGAAAGACTCAAGGCACCTCTCAAGGCACCTCA
ACACCTGGAAACAGGCCAGCAAAAACCAAGAAGCCACCTGTGTATCCGGCAGCTGTACGAGACACCAAGGCCACT
GGCGCCTACTGGACGTGCAAAATCTTGCAGGATTTGCACAGGATCACAGGAACAAGGTTCTTGTTGCCGCCGAAG
CCACCATGTTCCGATAAGAGGGCTGGCGAAGTGTCTGAAGACTTGGAGACGGAGGCTTTATCCAGCGACTTGGCC
CCCCAAGCACCGCCTCAAAAGCTCGAGACCAAAAAGAGCAAGCCACGCCCAAGACAGGCCAAGAAGATAATATCA
AATATCACCAAGCGGAAAAAGCAGCCGCCGTCGACGCTGAATCCTAATCGTGAAAGGCCTCGGCAGACAAAGCAG
AAGCAAAAGGCACCGAGTATGGCCTTGACGGGGATGGAGATTCCCTTGAGTTCCATTCTCAATGCAGTCAAAGAA
AATCCGCGAATTCGCAAACGGAAAAAAATTGATGGGGAAGAGGTTCCTGCACCATGTATTGGCAGGAAACGCGGC
GTCAACGGCCAAAATCATGACCAGTCAATCCCCCCAGAACTCAAACTGGCTCCCTTTCAATCCCCAGCTGCCCCA
GAGACAACGCTACCACTCAAGTACGGCAAGCCGGAACCTCTTGAACCTCGAAGTCCACCATCTGGTCCGCTCATG
TCTCTATCGCCGAATCTTCGAAGCTTTGGATCGAGCACATATAGTTCTTTGTACTCGGACTGCCAGCCCGTTTGG
GGTACCCAGGAGGCAATTATGCCGGCGCTGAAGCCAACGCAGCTTGGACTACCGTTGCCGCAACTCCAGAGAGCT
TAG
Transcript >OphauG2|202
ATGCCAACTGTGCACGCCTTGCCTCAATCCCACGACCATCTTAGCCACGTCGCCAGCTCTCTGCTCAAGGCGCGC
AAGGTTGTCGTCATCACGGGCGCCGGCATCAGCACCAATTCGGGCATTCCGGACTTTCGCTCCGACAATGGCCTT
TACTCCCTCATACAGGCCCAATTCGAGCATGTCGCGCGTCAACCGCGTCAGCCAGACCTACATGTCCGTGGAAAT
GTCGCCCTGCCGCCCTCGTCTGTGTCCCGCGTCGCACCCGATGCCGACGCGTCTTTGGACACCATTTACGTCAAG
TCGCCCTCTATAGACGCCAATGACGCTGCACAAAGGGACCTCGATTCGTTTGACGTGAATTCTTCACCCCCTGCT
TGTCCCCACCCTGCAACCTCGCCGCTCTCTTCTCCCCCCCCTAGCAGCATCTTCAACTCGCCCACCACCCATGCT
TACAAACACCGCAAACCCTCGATTGACGTGATTCTGCCCTTGAGCTCATCTCCTCCATCATCACCCTCCCCGTCT
GGAATTGCATCTCCCTCTCTCCCATCCTCGACAAGCTCCCTCACCGGCCATGGCTCAAGCAGACAGGACAGTCCA
TATCCAGAACAAAACCAGACCAACAATGCATCAAAGCCATTGGATTCGTCCCAAACCTCGACTTCGAGCAGAAAC
TCACTTCCCAGCGTCAACATGAAAGGCAGGGATCTCTTTGACGCTGCTATTTGGTCGGATCCTCTTCGAACTTCG
GTTTTCTACACATTTGCTACTTCTCTTCGACAAAAGGTCAAGACGGCAGAGCCCACCGACTCTCATCGATTCATT
GGCCACCTTAGAGATCGTGGGAAGCTGGTTCGTTGCTACACGCAAAACATTGACCAAATCGAAGAAAAAGTGGGC
TTGAAAACCTGTCTGCAAGCTGGACCTGGCAACCGGGGGCGCTTTTCTCGCCGCTCAGCTGCAAACTCAAGGCAA
CTTGACAAGATGGTGCCAGACACGTCACTATGCTCCAATGAACAAGCAACTTTGGATGATGCAAATAGCACCGAG
CCCAGCAGTTCACCTGACAGTGAATCAGGTGAAGCAGGACAAGCAACTCTTTTGAACCCAGGTTTCGAGCCAGAC
GCTTCCGAGTCTCAGGATAGTTTTCAGCCACAAAAGCTGCCAGGGTCGCATGGCGTTGAATGCGTCTTTCTGCAT
GGGTCCCTCGAGAGATTAAGATGCTTTCGCTGTGCTCAGCTCTGCTCGTGGGATGATGAGCGCGAGGCCGAGACG
CTTACTGGCCAGCAGCCCGAGTGTCCGCACTGCGCTGGTGCCACGGCAGCGCGAGAAGAAAAGGGAAAACGTGCT
CTGGGGGTTGGAAAACTACGACCAGACATTGTACTGTATGGCGAGGAGCACCCCAACTCACATCTCATCAGCCCC
ATCATTACCCATGACCTGAGTCTACATCCCGACATGCTCCTTATTCTCGGCACAAGCTTGAGGGTCCACGGACTA
AAAGTAATGGTTCGCGAGTTTGCAAAGGCTGTCCACAGCAAAGGGGGAAAGGTGGTCTTTGTCAACTTTACCAAG
CCTCCCTCGTGGGGAGACATGATTGACTACTGGATTCAGTGGGATTGCGACGCTTGGGTAGCAGACTTGCAAAGC
AGAGTCCCGCAACTCTGGAAGCCGCATAGCACGTCTCACAAGGGAAAGACTCAAGGCACCTCTCAAGGCACCTCA
ACACCTGGAAACAGGCCAGCAAAAACCAAGAAGCCACCTGTGTATCCGGCAGCTGTACGAGACACCAAGGCCACT
GGCGCCTACTGGACGTGCAAAATCTTGCAGGATTTGCACAGGATCACAGGAACAAGGTTCTTGTTGCCGCCGAAG
CCACCATGTTCCGATAAGAGGGCTGGCGAAGTGTCTGAAGACTTGGAGACGGAGGCTTTATCCAGCGACTTGGCC
CCCCAAGCACCGCCTCAAAAGCTCGAGACCAAAAAGAGCAAGCCACGCCCAAGACAGGCCAAGAAGATAATATCA
AATATCACCAAGCGGAAAAAGCAGCCGCCGTCGACGCTGAATCCTAATCGTGAAAGGCCTCGGCAGACAAAGCAG
AAGCAAAAGGCACCGAGTATGGCCTTGACGGGGATGGAGATTCCCTTGAGTTCCATTCTCAATGCAGTCAAAGAA
AATCCGCGAATTCGCAAACGGAAAAAAATTGATGGGGAAGAGGTTCCTGCACCATGTATTGGCAGGAAACGCGGC
GTCAACGGCCAAAATCATGACCAGTCAATCCCCCCAGAACTCAAACTGGCTCCCTTTCAATCCCCAGCTGCCCCA
GAGACAACGCTACCACTCAAGTACGGCAAGCCGGAACCTCTTGAACCTCGAAGTCCACCATCTGGTCCGCTCATG
TCTCTATCGCCGAATCTTCGAAGCTTTGGATCGAGCACATATAGTTCTTTGTACTCGGACTGCCAGCCCGTTTGG
GGTACCCAGGAGGCAATTATGCCGGCGCTGAAGCCAACGCAGCTTGGACTACCGTTGCCGCAACTCCAGAGAGCT
TAG
Gene >OphauG2|202
ATGCCAACTGTGCACGCCTTGCCTCAATCCCACGACCATCTTAGCCACGTCGCCAGCTCTCTGCTCAAGGCGCGC
AAGGTTGTCGTCATCACGGGCGCCGGCATCAGCACCAATTCGGGCATTCCGGTAAGCTGCTGCAGCCCAGCAAGC
GCGTCGCACATGACACGAGGCTAATGGGCCCGACAGGACTTTCGCTCCGACAATGGCCTTTACTCCCTCATACAG
GCCCAATTCGAGCATGTCGCGCGTCAACCGCGTCAGCCAGACCTACATGTCCGTGGAAATGTCGCCCTGCCGCCC
TCGTCTGTGTCCCGCGTCGCACCCGATGCCGACGCGTCTTTGGACACCATTTACGTCAAGTCGCCCTCTATAGAC
GCCAATGACGCTGCACAAAGGGACCTCGATTCGTTTGACGTGAATTCTTCACCCCCTGCTTGTCCCCACCCTGCA
ACCTCGCCGCTCTCTTCTCCCCCCCCTAGCAGCATCTTCAACTCGCCCACCACCCATGCTTACAAACACCGCAAA
CCCTCGATTGACGTGATTCTGCCCTTGAGCTCATCTCCTCCATCATCACCCTCCCCGTCTGGAATTGCATCTCCC
TCTCTCCCATCCTCGACAAGCTCCCTCACCGGCCATGGCTCAAGCAGACAGGACAGTCCATATCCAGAACAAAAC
CAGACCAACAATGCATCAAAGCCATTGGATTCGTCCCAAACCTCGACTTCGAGCAGAAACTCACTTCCCAGCGTC
AACATGAAAGGCAGGGATCTCTTTGACGCTGCTATTTGGTCGGATCCTCTTCGAACTTCGGTTTTCTACACATTT
GCTACTTCTCTTCGACAAAAGGTCAAGACGGCAGAGCCCACCGACTCTCATCGATTCATTGGCCACCTTAGAGAT
CGTGGGAAGCTGGTTCGTTGCTACACGCAAAACATTGACCAAATCGAAGAAAAAGTGGGCTTGAAAACCTGTCTG
CAAGCTGGACCTGGCAACCGGGGGCGCTTTTCTCGCCGCTCAGCTGCAAACTCAAGGCAACTTGACAAGATGGTG
CCAGACACGTCACTATGCTCCAATGAACAAGCAACTTTGGATGATGCAAATAGCACCGAGCCCAGCAGTTCACCT
GACAGTGAATCAGGTGAAGCAGGACAAGCAACTCTTTTGAACCCAGGTTTCGAGCCAGACGCTTCCGAGTCTCAG
GATAGTTTTCAGCCACAAAAGCTGCCAGGGTCGCATGGCGTTGAATGCGTCTTTCTGCATGGGTCCCTCGAGAGA
TTAAGATGCTTTCGCTGTGCTCAGCTCTGCTCGTGGGATGATGAGCGCGAGGCCGAGACGCTTACTGGCCAGCAG
CCCGAGTGTCCGCACTGCGCTGGTGCCACGGCAGCGCGAGAAGAAAAGGGAAAACGTGCTCTGGGGGTTGGAAAA
CTACGACCAGACATTGTACTGTATGGCGAGGAGCACCCCAACTCACATCTCATCAGCCCCATCATTACCCATGAC
CTGAGTCTACATCCCGACATGCTCCTTATTCTCGGCACAAGCTTGAGGGTCCACGGACTAAAAGTAATGGTTCGC
GAGTTTGCAAAGGCTGTCCACAGCAAAGGGGGAAAGGTGGTCTTTGTCAACTTTACCAAGCCTCCCTCGTGGGGA
GACATGATTGACTACTGGATTCAGTGGGATTGCGACGCTTGGGTAGCAGACTTGCAAAGCAGAGTCCCGCAACTC
TGGAAGCCGCATAGCACGTCTCACAAGGGAAAGACTCAAGGCACCTCTCAAGGCACCTCAACACCTGGAAACAGG
CCAGCAAAAACCAAGAAGCCACCTGTGTATCCGGCAGCTGTACGAGACACCAAGGCCACTGGCGCCTACTGGACG
TGCAAAATCTTGCAGGATTTGCACAGGATCACAGGAACAAGGTTCTTGTTGCCGCCGAAGCCACCATGTTCCGAT
AAGAGGGCTGGCGAAGTGTCTGAAGACTTGGAGACGGAGGCTTTATCCAGCGACTTGGCCCCCCAAGCACCGCCT
CAAAAGCTCGAGACCAAAAAGAGCAAGCCACGCCCAAGACAGGCCAAGAAGATAATATCAAATATCACCAAGCGG
AAAAAGCAGCCGCCGTCGACGCTGAATCCTAATCGTGAAAGGCCTCGGCAGACAAAGCAGAAGCAAAAGGCACCG
AGTATGGCCTTGACGGGGATGGAGATTCCCTTGAGTTCCATTCTCAATGCAGTCAAAGAAAATCCGCGAATTCGC
AAACGGAAAAAAATTGATGGGGAAGAGGTTCCTGCACCATGTATTGGCAGGAAACGCGGCGTCAACGGCCAAAAT
CATGACCAGTCAATCCCCCCAGAACTCAAACTGGCTCCCTTTCAATCCCCAGCTGCCCCAGAGACAACGCTACCA
CTCAAGTACGGCAAGCCGGAACCTCTTGAACCTCGAAGTCCACCATCTGGTCCGCTCATGTCTCTATCGCCGAAT
CTTCGAAGCTTTGGATCGAGCACATATAGTTCTTTGTACTCGGACTGCCAGCCCGTTTGGGGTACCCAGGAGGCA
ATTATGCCGGCGCTGAAGCCAACGCAGCTTGGACTACCGTTGCCGCAACTCCAGAGAGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail