Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2018
Gene name
LocationContig_167:19481..20675
Strand-
Gene length (bp)1194
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O60024|ALL4_ASPFU Allergen Asp f 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G03830 PE=1 SV=2 190 397 6.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2018
MKISTTSLLLAGVLGAVAHPSRHAHRLAHRSLDRRTDFVRAAKPEDAPPVVEEIEYVTYTETTWVLAPDATEAPA
PETTAAQPAVVMSTAAQVAAPSSAALPNPAPQAPQPPPQVPQPQPPQNLVVPPSPSVPAAPATSIAVPAPAPNSG
SKSGSSSDSSSSSGSGGVGASMYQPFCGGKPHKRATIEQIAYKGNVGSAEYGCNMKLVQSQIADKYDYTLRFHNA
GDQNQKCICWNKYGPTNQIDGFFSSNNKALKFDLAPGAEQYLAVDSDSQGGCTCDAGEVQTTKVGQWAGTWVEYD
FGNESNKKWSGADASCIVAAKEKQSDPNIRIPGMKVCDNVALGKTKRTEGDMDKHCSTINNGGTGTNAYLGGTEA
LDGVGMNIQNSPVRLDVTVDYK*
Coding >OphauG2|2018
ATGAAGATTTCCACAACATCACTCCTCCTGGCCGGTGTCCTTGGCGCCGTCGCCCACCCGAGCCGCCATGCTCAC
CGTCTTGCCCACCGCTCGCTGGACCGCCGCACCGACTTTGTCCGGGCTGCTAAGCCCGAGGACGCACCGCCCGTT
GTCGAAGAGATTGAATATGTTACCTACACGGAGACTACCTGGGTCCTGGCTCCAGATGCCACTGAAGCTCCGGCC
CCAGAGACGACGGCTGCTCAACCTGCTGTAGTGATGTCGACGGCTGCTCAAGTCGCTGCACCCTCTTCTGCGGCT
CTCCCGAACCCAGCTCCCCAGGCTCCTCAGCCTCCTCCCCAAGTTCCTCAACCTCAGCCTCCTCAGAACTTGGTT
GTGCCGCCGAGCCCCAGCGTCCCCGCGGCCCCTGCCACGTCGATTGCTGTTCCGGCTCCTGCCCCCAACTCTGGA
TCCAAGTCTGGTTCCAGCTCCGACTCCAGCTCGAGCTCGGGATCGGGCGGCGTGGGCGCCAGCATGTATCAACCC
TTTTGCGGTGGCAAGCCACACAAGCGCGCTACGATTGAGCAGATTGCCTACAAGGGCAATGTTGGTTCCGCTGAA
TATGGCTGCAACATGAAGCTGGTACAGAGCCAGATTGCCGACAAGTACGACTATACGCTCCGGTTCCACAATGCT
GGTGACCAGAACCAGAAGTGTATCTGCTGGAACAAGTATGGCCCCACAAACCAGATTGATGGCTTCTTTTCCAGC
AACAACAAGGCCCTCAAATTTGACCTGGCTCCTGGCGCTGAGCAATACCTTGCTGTCGATTCGGACTCGCAGGGT
GGCTGCACTTGCGATGCTGGCGAGGTTCAGACGACCAAAGTGGGCCAGTGGGCTGGCACCTGGGTCGAATACGAC
TTTGGCAACGAGTCCAACAAGAAATGGTCTGGTGCCGACGCCTCGTGCATTGTTGCTGCCAAGGAAAAGCAGAGT
GACCCCAATATTCGTATCCCCGGCATGAAGGTGTGCGACAATGTTGCACTCGGCAAGACAAAGCGAACCGAAGGC
GACATGGACAAGCATTGCTCCACCATCAACAACGGCGGCACAGGCACCAACGCCTATCTGGGAGGCACCGAGGCT
TTGGACGGAGTTGGCATGAACATCCAGAACAGTCCTGTCCGCTTGGATGTCACTGTCGACTACAAGTAG
Transcript >OphauG2|2018
ATGAAGATTTCCACAACATCACTCCTCCTGGCCGGTGTCCTTGGCGCCGTCGCCCACCCGAGCCGCCATGCTCAC
CGTCTTGCCCACCGCTCGCTGGACCGCCGCACCGACTTTGTCCGGGCTGCTAAGCCCGAGGACGCACCGCCCGTT
GTCGAAGAGATTGAATATGTTACCTACACGGAGACTACCTGGGTCCTGGCTCCAGATGCCACTGAAGCTCCGGCC
CCAGAGACGACGGCTGCTCAACCTGCTGTAGTGATGTCGACGGCTGCTCAAGTCGCTGCACCCTCTTCTGCGGCT
CTCCCGAACCCAGCTCCCCAGGCTCCTCAGCCTCCTCCCCAAGTTCCTCAACCTCAGCCTCCTCAGAACTTGGTT
GTGCCGCCGAGCCCCAGCGTCCCCGCGGCCCCTGCCACGTCGATTGCTGTTCCGGCTCCTGCCCCCAACTCTGGA
TCCAAGTCTGGTTCCAGCTCCGACTCCAGCTCGAGCTCGGGATCGGGCGGCGTGGGCGCCAGCATGTATCAACCC
TTTTGCGGTGGCAAGCCACACAAGCGCGCTACGATTGAGCAGATTGCCTACAAGGGCAATGTTGGTTCCGCTGAA
TATGGCTGCAACATGAAGCTGGTACAGAGCCAGATTGCCGACAAGTACGACTATACGCTCCGGTTCCACAATGCT
GGTGACCAGAACCAGAAGTGTATCTGCTGGAACAAGTATGGCCCCACAAACCAGATTGATGGCTTCTTTTCCAGC
AACAACAAGGCCCTCAAATTTGACCTGGCTCCTGGCGCTGAGCAATACCTTGCTGTCGATTCGGACTCGCAGGGT
GGCTGCACTTGCGATGCTGGCGAGGTTCAGACGACCAAAGTGGGCCAGTGGGCTGGCACCTGGGTCGAATACGAC
TTTGGCAACGAGTCCAACAAGAAATGGTCTGGTGCCGACGCCTCGTGCATTGTTGCTGCCAAGGAAAAGCAGAGT
GACCCCAATATTCGTATCCCCGGCATGAAGGTGTGCGACAATGTTGCACTCGGCAAGACAAAGCGAACCGAAGGC
GACATGGACAAGCATTGCTCCACCATCAACAACGGCGGCACAGGCACCAACGCCTATCTGGGAGGCACCGAGGCT
TTGGACGGAGTTGGCATGAACATCCAGAACAGTCCTGTCCGCTTGGATGTCACTGTCGACTACAAGTAG
Gene >OphauG2|2018
ATGAAGATTTCCACAACATCACTCCTCCTGGCCGGTGTCCTTGGCGCCGTCGCCCACCCGAGCCGCCATGCTCAC
CGTCTTGCCCACCGCTCGCTGGACCGCCGCACCGACTTTGTCCGGGCTGCTAAGCCCGAGGACGCACCGCCCGTT
GTCGAAGAGATTGAATATGTTACCTACACGGAGACTACCTGGGTCCTGGCTCCAGATGCCACTGAAGCTCCGGCC
CCAGAGACGACGGCTGCTCAACCTGCTGTAGTGATGTCGACGGCTGCTCAAGTCGCTGCACCCTCTTCTGCGGCT
CTCCCGAACCCAGCTCCCCAGGCTCCTCAGCCTCCTCCCCAAGTTCCTCAACCTCAGCCTCCTCAGAACTTGGTT
GTGCCGCCGAGCCCCAGCGTCCCCGCGGCCCCTGCCACGTCGATTGCTGTTCCGGCTCCTGCCCCCAACTCTGGA
TCCAAGTCTGGTTCCAGCTCCGACTCCAGCTCGAGCTCGGGATCGGGCGGCGTGGGCGCCAGCATGTATCAACCC
TTTTGCGGTGGCAAGCCACACAAGCGCGCTACGATTGAGCAGATTGCCTACAAGGGCAATGTTGGTTCCGCTGAA
TATGGCTGCAACATGAAGCTGGTACAGAGCCAGATTGCCGACAAGTACGACTATACGCTCCGGTTCCACAATGCT
GGTGACCAGAACCAGAAGTGTATCTGCTGGAACAAGTATGGCCCCACAAACCAGATTGATGGCTTCTTTTCCAGC
AACAACAAGGCCCTCAAATTTGACCTGGCTCCTGGCGCTGAGCAATACCTTGCTGTCGATTCGGACTCGCAGGGT
GGCTGCACTTGCGATGCTGGCGAGGTTCAGACGACCAAAGTGGGCCAGTGGGCTGGCACCTGGGTCGAATACGAC
TTTGGCAACGAGTCCAACAAGAAATGGTCTGGTGCCGACGCCTCGTGCATTGTTGCTGCCAAGGAAAAGCAGAGT
GACCCCAATATTCGTATCCCCGGCATGAAGGTGTGCGACAATGTTGCACTCGGCAAGACAAAGCGAACCGAAGGC
GACATGGACAAGCATTGCTCCACCATCAACAACGGCGGCACAGGCACCAACGCCTATCTGGGAGGCACCGAGGCT
TTGGACGGAGTTGGCATGAACATCCAGAACAGTCCTGTCCGCTTGGATGTCACTGTCGACTACAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail