Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2014
Gene name
LocationContig_167:6105..11648
Strand-
Gene length (bp)5543
Transcript length (bp)5493
Coding sequence length (bp)5493
Protein length (aa) 1831

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01369 Sec7 Sec7 domain 7.8E-70 626 809
PF20252 BIG2_C BIG2 C-terminal domain 7.6E-57 1607 1786
PF12783 Sec7_N Guanine nucleotide exchange factor in Golgi transport N-terminal 1.1E-41 303 474
PF09324 DUF1981 Domain of unknown function (DUF1981) 1.9E-32 1169 1251
PF16213 DCB Dimerisation and cyclophilin-binding domain of Mon2 3.2E-24 3 185

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7V5|SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec72 PE=1 SV=1 7 1798 0.0E+00
sp|F4JSZ5|BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana GN=BIG1 PE=2 SV=1 5 1510 0.0E+00
sp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1 290 1777 0.0E+00
sp|F4IXW2|BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana GN=BIG5 PE=1 SV=2 47 1770 0.0E+00
sp|Q9LPC5|BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana GN=BIG3 PE=1 SV=1 43 1493 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7V5|SEC7B_SCHPO Protein transport protein sec72 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec72 PE=1 SV=1 7 1798 0.0E+00
sp|F4JSZ5|BIG1_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Arabidopsis thaliana GN=BIG1 PE=2 SV=1 5 1510 0.0E+00
sp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1 290 1777 0.0E+00
sp|F4IXW2|BIG5_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 5 OS=Arabidopsis thaliana GN=BIG5 PE=1 SV=2 47 1770 0.0E+00
sp|Q9LPC5|BIG3_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Arabidopsis thaliana GN=BIG3 PE=1 SV=1 43 1493 0.0E+00
sp|O46382|BIG1_BOVIN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Bos taurus GN=ARFGEF1 PE=1 SV=1 273 1792 0.0E+00
sp|G3X9K3|BIG1_MOUSE Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Mus musculus GN=Arfgef1 PE=1 SV=1 273 1792 0.0E+00
sp|P11075|SEC7_YEAST Protein transport protein SEC7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC7 PE=1 SV=2 2 1797 0.0E+00
sp|D4A631|BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus GN=Arfgef1 PE=1 SV=1 276 1792 0.0E+00
sp|Q9UT02|SEC7A_SCHPO Protein transport protein sec71 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec71 PE=1 SV=1 6 1783 0.0E+00
sp|Q9Y6D5|BIG2_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens GN=ARFGEF2 PE=1 SV=3 6 1792 0.0E+00
sp|Q7TSU1|BIG2_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Rattus norvegicus GN=Arfgef2 PE=1 SV=1 6 1792 0.0E+00
sp|A2A5R2|BIG2_MOUSE Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Mus musculus GN=Arfgef2 PE=1 SV=1 6 1792 0.0E+00
sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens GN=ARFGEF1 PE=1 SV=2 273 1792 0.0E+00
sp|F4JN05|BIG4_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 4 OS=Arabidopsis thaliana GN=BIG4 PE=3 SV=1 5 1397 1.0E-180
sp|Q42510|GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana GN=GN PE=1 SV=1 616 1391 5.0E-54
sp|Q54KA7|SECG_DICDI Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 615 820 4.0E-52
sp|Q92538|GBF1_HUMAN Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens GN=GBF1 PE=1 SV=2 285 1140 5.0E-48
sp|Q9FLY5|GNL1_ARATH ARF guanine-nucleotide exchange factor GNL1 OS=Arabidopsis thaliana GN=GNL1 PE=3 SV=1 620 1382 8.0E-48
sp|Q9R1D7|GBF1_CRIGR Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Cricetulus griseus GN=GBF1 PE=1 SV=1 396 1231 9.0E-47
sp|Q99418|CYH2_HUMAN Cytohesin-2 OS=Homo sapiens GN=CYTH2 PE=1 SV=2 618 804 7.0E-46
sp|Q76MY7|CYH2_CHLAE Cytohesin-2 OS=Chlorocebus aethiops GN=CYTH2 PE=2 SV=1 618 804 7.0E-46
sp|Q2KI41|CYH2_BOVIN Cytohesin-2 OS=Bos taurus GN=CYTH2 PE=2 SV=1 618 804 7.0E-46
sp|O43739|CYH3_HUMAN Cytohesin-3 OS=Homo sapiens GN=CYTH3 PE=1 SV=2 622 804 1.0E-45
sp|P97696|CYH3_RAT Cytohesin-3 OS=Rattus norvegicus GN=Cyth3 PE=2 SV=1 622 804 2.0E-45
sp|O08967|CYH3_MOUSE Cytohesin-3 OS=Mus musculus GN=Cyth3 PE=1 SV=1 622 804 2.0E-45
sp|P63035|CYH2_RAT Cytohesin-2 OS=Rattus norvegicus GN=Cyth2 PE=1 SV=1 618 804 3.0E-45
sp|P63034|CYH2_MOUSE Cytohesin-2 OS=Mus musculus GN=Cyth2 PE=1 SV=2 618 804 3.0E-45
sp|Q80YW0|CYH4_MOUSE Cytohesin-4 OS=Mus musculus GN=Cyth4 PE=1 SV=1 636 806 6.0E-45
sp|P97694|CYH1_RAT Cytohesin-1 OS=Rattus norvegicus GN=Cyth1 PE=1 SV=1 636 804 3.0E-44
sp|Q9QX11|CYH1_MOUSE Cytohesin-1 OS=Mus musculus GN=Cyth1 PE=1 SV=2 636 804 3.0E-44
sp|Q15438|CYH1_HUMAN Cytohesin-1 OS=Homo sapiens GN=CYTH1 PE=1 SV=1 618 804 5.0E-44
sp|Q76MZ1|CYH1_CHLAE Cytohesin-1 OS=Chlorocebus aethiops GN=CYTH1 PE=2 SV=1 618 804 5.0E-44
sp|Q9UIA0|CYH4_HUMAN Cytohesin-4 OS=Homo sapiens GN=CYTH4 PE=2 SV=1 636 806 8.0E-43
sp|F4K2K3|GNL2_ARATH ARF guanine-nucleotide exchange factor GNL2 OS=Arabidopsis thaliana GN=GNL2 PE=2 SV=1 618 814 2.0E-39
sp|Q76M68|IQEC3_RAT IQ motif and SEC7 domain-containing protein 3 OS=Rattus norvegicus GN=Iqsec3 PE=1 SV=1 620 809 2.0E-35
sp|Q3TES0|IQEC3_MOUSE IQ motif and SEC7 domain-containing protein 3 OS=Mus musculus GN=Iqsec3 PE=1 SV=1 620 809 3.0E-35
sp|Q9UPP2|IQEC3_HUMAN IQ motif and SEC7 domain-containing protein 3 OS=Homo sapiens GN=IQSEC3 PE=2 SV=3 620 809 3.0E-35
sp|Q9P7R8|YHV3_SCHPO Uncharacterized protein C211.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC211.03c PE=1 SV=1 608 943 4.0E-35
sp|Q8R0S2|IQEC1_MOUSE IQ motif and SEC7 domain-containing protein 1 OS=Mus musculus GN=Iqsec1 PE=1 SV=2 626 809 2.0E-34
sp|Q6DN90|IQEC1_HUMAN IQ motif and SEC7 domain-containing protein 1 OS=Homo sapiens GN=IQSEC1 PE=1 SV=1 626 809 4.0E-34
sp|Q5DU25|IQEC2_MOUSE IQ motif and SEC7 domain-containing protein 2 OS=Mus musculus GN=Iqsec2 PE=1 SV=3 637 809 1.0E-31
sp|Q5JU85|IQEC2_HUMAN IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens GN=IQSEC2 PE=1 SV=1 637 809 1.0E-31
sp|P47102|GEA1_YEAST ARF guanine-nucleotide exchange factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEA1 PE=1 SV=1 622 817 2.0E-28
sp|Q9Y6D6|BIG1_HUMAN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Homo sapiens GN=ARFGEF1 PE=1 SV=2 6 219 2.0E-27
sp|P39993|GEA2_YEAST ARF guanine-nucleotide exchange factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GEA2 PE=1 SV=1 622 817 2.0E-27
sp|O46382|BIG1_BOVIN Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Bos taurus GN=ARFGEF1 PE=1 SV=1 6 219 3.0E-27
sp|G3X9K3|BIG1_MOUSE Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Mus musculus GN=Arfgef1 PE=1 SV=1 6 219 4.0E-27
sp|D4A631|BIG1_RAT Brefeldin A-inhibited guanine nucleotide-exchange protein 1 OS=Rattus norvegicus GN=Arfgef1 PE=1 SV=1 6 219 5.0E-27
sp|P34512|GRP1_CAEEL GTP exchange factor for ARFs 1 OS=Caenorhabditis elegans GN=grp-1 PE=3 SV=2 622 817 1.0E-22
sp|Q8NDX1|PSD4_HUMAN PH and SEC7 domain-containing protein 4 OS=Homo sapiens GN=PSD4 PE=1 SV=2 567 819 1.0E-17
sp|Q9ESQ7|PSD1_RAT PH and SEC7 domain-containing protein 1 OS=Rattus norvegicus GN=Psd PE=1 SV=1 662 809 2.0E-17
sp|Q5DTT2|PSD1_MOUSE PH and SEC7 domain-containing protein 1 OS=Mus musculus GN=Psd PE=1 SV=2 662 809 3.0E-17
sp|A5PKW4|PSD1_HUMAN PH and SEC7 domain-containing protein 1 OS=Homo sapiens GN=PSD PE=1 SV=2 662 809 3.0E-17
sp|Q8BLR5|PSD4_MOUSE PH and SEC7 domain-containing protein 4 OS=Mus musculus GN=Psd4 PE=1 SV=1 651 818 2.0E-16
sp|Q9NYI0|PSD3_HUMAN PH and SEC7 domain-containing protein 3 OS=Homo sapiens GN=PSD3 PE=1 SV=2 660 809 3.0E-15
sp|Q2PFD7|PSD3_MOUSE PH and SEC7 domain-containing protein 3 OS=Mus musculus GN=Psd3 PE=1 SV=2 660 823 4.0E-15
sp|Q9LZX8|BIG2_ARATH Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Arabidopsis thaliana GN=BIG2 PE=2 SV=1 43 185 1.0E-14
sp|Q9QZN3|FBX8_MOUSE F-box only protein 8 OS=Mus musculus GN=Fbxo8 PE=2 SV=2 637 804 4.0E-14
sp|Q5E9G6|FBX8_BOVIN F-box only protein 8 OS=Bos taurus GN=FBXO8 PE=2 SV=1 637 804 8.0E-14
sp|Q9NRD0|FBX8_HUMAN F-box only protein 8 OS=Homo sapiens GN=FBXO8 PE=2 SV=1 637 804 8.0E-14
sp|Q6P1I6|PSD2_MOUSE PH and SEC7 domain-containing protein 2 OS=Mus musculus GN=Psd2 PE=1 SV=1 661 809 4.0E-13
sp|Q9BQI7|PSD2_HUMAN PH and SEC7 domain-containing protein 2 OS=Homo sapiens GN=PSD2 PE=2 SV=3 661 809 4.0E-13
sp|F1MUS9|PSD1_BOVIN PH and SEC7 domain-containing protein 1 OS=Bos taurus GN=PSD PE=2 SV=1 662 809 1.0E-12
sp|Q6GP04|MON2_XENLA Protein MON2 homolog OS=Xenopus laevis GN=mon2 PE=2 SV=1 963 1253 8.0E-12
sp|O13817|SEC7C_SCHPO Protein transport protein sec73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec73 PE=3 SV=2 681 780 4.0E-11
sp|Q7Z3U7|MON2_HUMAN Protein MON2 homolog OS=Homo sapiens GN=MON2 PE=1 SV=3 963 1381 1.0E-10
sp|Q80TL7|MON2_MOUSE Protein MON2 homolog OS=Mus musculus GN=Mon2 PE=1 SV=2 963 1381 1.0E-10
sp|Q29L43|MON2_DROPS Protein MON2 homolog OS=Drosophila pseudoobscura pseudoobscura GN=mon2 PE=3 SV=2 957 1393 3.0E-10
sp|Q10491|SEC74_SCHPO Arf guanine nucleotide exchange factor sec74 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec74 PE=1 SV=2 709 782 5.0E-09
sp|Q42510|GNOM_ARATH ARF guanine-nucleotide exchange factor GNOM OS=Arabidopsis thaliana GN=GN PE=1 SV=1 23 490 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032012 regulation of ARF protein signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0023051 regulation of signaling No
GO:0050794 regulation of cellular process No
GO:1902531 regulation of intracellular signal transduction No
GO:0030695 GTPase regulator activity No
GO:0065007 biological regulation No
GO:0008150 biological_process No
GO:0009966 regulation of signal transduction No
GO:0010646 regulation of cell communication No
GO:0051056 regulation of small GTPase mediated signal transduction No
GO:0098772 molecular function regulator activity No
GO:0046578 regulation of Ras protein signal transduction No
GO:0030234 enzyme regulator activity No
GO:0048583 regulation of response to stimulus No
GO:0050789 regulation of biological process No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2014
MSSLRFVVSSLEAIAASKDSQRNKQLAESTKQALDAIKEQDQLPDPEIVFAPLQLATRSNNPQLTTTALDCIGKL
ISYSYFSIANSRDEAPEEGAQPASPLIERAIDTICDCFQGETTAVEIQLQIVKSLLAAVLNDKIVVHGAGLLKAV
RQVYNVFLLSRSTSNQQVAQGTLTQMVGTVFERVKTRLHMKEARLNLANLKHSSSNVTFDPSEHSQPVSADANDS
SASVPAPESEVGAKLTLKDLEHRKSFDDSNLGDGPTMVTRLAPAKKESADTPVSAPSSPETPSPSDSDALDAEDE
VYIRDAYLVFRSFCNLSTKVLPPDQLFDLRGQPMRSKLISLHIIHTLLNNNIAVFTSPLCTIKSSKSNEPTSFLQ
AIKFYLCLSITRNGASTVDRIFDVCCEIFWLMLKYMRPSFKKEIEVFLNEIYLALLSRRNAPVSQKLYFVTILNR
LCADPRALVEIYLNYDCDQTVDNIFQTIVEDLSKFSTTPVAITTINEQVYEELRAKTAPASEWQLRGILPPPLTV
AQIVPQAENEPDFPKHYAIKRLSLEALVEALRSLLNWSASIRSDSGEAPKADGDNRPSMDELRPSIDPTASDSAS
RLETPLPPSTPIIDDDPEHLEKEKARKTALTNAIGQFNFKPKKGIKLLLRDGFIPSSSPKDIASFLIKEDKLDKA
QIGEYLGEGDQQNIDIMHAFVDSMEFAKKRFVDALRQFLQSFRLPGEAQKIDRFMLKFAERYVMDNPNAFANADT
AYVLAYSVIMLNTDQHSGKVAKRMSKEEFIKNNRGINDNADLPDEYLISIFDEIATNEIVLTSEREAAAAAGTLS
VQATGLTAGLGQAFSNVGRDLQREAYVQQSEEISLRSEQLFKNLFKTQRRNTAKTGPKFIPATSSKHVGYMFDVT
WMSFFSALSSQMQKAHNLEVSKLCLEGMKLATKIACLFELSTPREAFISALRNTTNLNNPQEMMAKNIEALKVLL
DLGQSEGNLLRESWKDILLCISQLDRLQLITGGVDESAIPDVSKARFVPPPRTDTSDSKSSTQSRAKARQRAGTG
SRGFSNEIALESRSDEFIRSVDHIFSNTAKLSGEAMVHFAKALTEVSWDEIKVSGSNESPRTYSLQKIVEISYYN
MNRVRFEWSNIWDVLGEHFNQVGCHNNMNIVVFALDSLRQLSMRFMEIEELAGFKFQKDFLKPFEHVLSNSDNMT
VKDLVLRCLIQMIQARGDNIRSGWRTMFGVFTVAAKEQHESIVNLAYENVNQVYKQKFGIVISQGAFTDLVVCLT
EFSKNLKFQKKSLAALELLKSIIPRMLKTPECPLSQLNSKPSEGSKSQVKTSVEEGFWFPVLFAFHDVLMTGEDL
EVRSNALEYFFAALVKHGGDFSPEFWDILWRQQLYPIFMVLRSRPEMSNALNHEEQSVWLSTTMIQALRNMITLF
THYFDALEYMLDRFLELLALCICQENDTIARIGSNCLQQLILKNVTKFTAEHWTKIVGAFCELFERTTAYQLFTA
ANMASSTSLSPPSNGFDLTGVAGVEPQIVDEKSLRINGGEDNGTMSDAESMQRQPSPKPADDELQASPGHGGQPL
EEFKPSSNLQQQPVVVTSARRRFFNRIISRCVLQLLMIETVNELFSNDTVYNHIPSTELLRLMALLKRSFQFARR
FNEDKELRMRLWREGFMKQPPNLLKQESGSAATYVSILFRMFADKAPERLESRPDIEAALVPLCKDIMTGYSALA
EESQHRNIMAWRPVVVDVLEGYATFPDEAFKAHTADFYPLAVDLLSRDLGPDLRAALLVVLRRVGEVCLGIDGLT
KASQIRRGSLVSDAHDDAAADGEAAARRML*
Coding >OphauG2|2014
ATGAGCTCCCTCAGGTTCGTCGTGTCCTCGCTCGAGGCCATTGCGGCCTCCAAGGATTCCCAGAGGAACAAGCAG
CTGGCCGAGTCGACCAAGCAAGCACTCGACGCCATCAAAGAACAGGACCAGCTGCCCGACCCTGAAATCGTATTT
GCCCCGCTGCAGCTGGCCACCAGGTCCAATAATCCGCAACTGACGACTACGGCCCTCGATTGCATCGGCAAACTC
ATCTCCTACTCATACTTTTCCATCGCCAACAGCCGAGACGAGGCGCCAGAAGAAGGCGCCCAGCCAGCTTCTCCC
TTGATAGAACGCGCCATCGACACAATATGCGATTGCTTCCAGGGCGAGACAACCGCTGTCGAGATTCAGCTGCAG
ATTGTCAAGTCGCTCCTGGCTGCTGTCCTAAACGACAAGATTGTTGTCCACGGCGCCGGCCTCCTCAAAGCCGTC
CGCCAGGTTTACAATGTCTTCCTCCTATCCAGGAGCACCTCTAACCAGCAGGTGGCTCAAGGAACTCTGACCCAG
ATGGTCGGAACTGTCTTTGAGCGCGTCAAGACGAGGCTGCACATGAAGGAAGCCAGGCTCAATTTAGCCAACCTC
AAGCATTCCTCGAGCAACGTCACCTTTGACCCCTCTGAACACTCACAGCCTGTCAGCGCCGATGCAAACGACTCG
TCTGCCTCTGTCCCAGCCCCAGAATCAGAAGTCGGCGCCAAGCTCACACTCAAGGATTTGGAGCATCGCAAGAGC
TTTGACGACTCAAACTTGGGCGATGGCCCGACCATGGTCACCAGACTGGCTCCTGCAAAAAAGGAGAGCGCGGAT
ACCCCGGTCTCGGCTCCCTCGTCGCCTGAAACTCCCAGTCCGTCTGATAGCGATGCCCTCGACGCTGAAGACGAA
GTATATATTCGTGATGCATATCTCGTCTTCCGCTCGTTTTGCAACTTGTCCACCAAGGTGCTACCACCTGACCAG
CTCTTTGATTTGCGCGGCCAACCCATGCGGTCAAAGCTCATCTCCCTTCACATTATTCACACCCTCCTCAATAAC
AACATTGCCGTCTTCACTTCGCCCCTGTGTACCATCAAGAGCTCCAAGAGCAACGAACCGACTTCCTTTCTCCAA
GCCATCAAGTTTTATCTATGTCTTAGCATCACGCGTAATGGTGCCAGTACTGTTGATCGCATTTTTGACGTGTGC
TGCGAGATTTTCTGGCTCATGCTCAAGTACATGCGTCCGTCGTTCAAGAAGGAAATCGAGGTGTTTCTCAACGAG
ATTTACCTGGCCCTCCTATCCCGCCGCAATGCACCTGTGTCGCAGAAGCTTTATTTTGTCACCATTCTCAACAGA
CTTTGTGCTGATCCTCGAGCATTGGTTGAGATTTACCTCAACTATGACTGCGACCAAACTGTTGATAACATTTTT
CAAACCATTGTTGAGGATTTGTCCAAATTTTCCACGACACCAGTCGCCATCACGACAATTAACGAGCAGGTGTAT
GAGGAGCTGCGAGCCAAAACGGCCCCTGCGAGTGAATGGCAACTCAGGGGCATTCTTCCTCCTCCCCTGACGGTG
GCTCAGATTGTGCCACAGGCAGAGAATGAACCCGACTTCCCCAAACATTACGCCATCAAACGCCTGTCCCTAGAG
GCGCTCGTCGAGGCACTAAGATCTTTGCTCAACTGGTCGGCCTCTATCCGCAGTGACAGCGGCGAGGCCCCCAAG
GCCGATGGCGACAATAGGCCCTCGATGGATGAGCTTAGACCGTCTATAGACCCAACGGCCAGCGATAGTGCTTCT
CGTCTGGAAACGCCCTTGCCGCCTTCAACACCTATTATTGACGATGATCCAGAACATCTCGAAAAAGAAAAGGCG
CGCAAGACGGCGCTCACAAATGCCATTGGACAATTCAACTTCAAGCCCAAAAAGGGAATCAAGTTGCTGCTGCGA
GACGGCTTCATACCCAGTAGCAGCCCCAAGGACATTGCAAGCTTTCTCATCAAGGAAGACAAATTGGATAAAGCG
CAGATTGGCGAGTATCTTGGCGAAGGCGATCAGCAAAATATTGACATCATGCACGCCTTTGTCGACTCGATGGAG
TTTGCCAAGAAGCGTTTTGTCGACGCCTTGCGACAGTTTCTGCAGTCTTTCCGACTTCCCGGCGAGGCACAGAAA
ATCGATCGATTCATGCTCAAGTTTGCAGAGCGCTATGTTATGGACAACCCCAACGCGTTTGCCAACGCCGACACG
GCATATGTGCTTGCATACTCGGTGATTATGCTCAACACGGATCAGCACAGTGGCAAGGTTGCCAAGAGAATGAGC
AAAGAAGAATTCATCAAGAACAACCGAGGCATCAATGACAATGCCGACTTGCCTGACGAGTATCTGATCAGCATT
TTTGATGAGATTGCCACCAACGAGATTGTTCTCACAAGTGAGCGTGAAGCCGCCGCCGCTGCCGGAACCTTGTCC
GTACAAGCTACTGGTCTTACGGCCGGTCTCGGCCAAGCCTTTTCCAATGTCGGGCGAGACTTGCAACGCGAGGCC
TATGTCCAGCAATCAGAAGAAATCTCGCTGCGATCAGAACAGCTGTTCAAGAACCTGTTCAAGACTCAGCGCAGA
AACACGGCAAAGACGGGTCCCAAGTTTATTCCAGCCACATCTTCCAAGCACGTTGGCTATATGTTTGACGTGACG
TGGATGTCCTTCTTCTCTGCCCTGTCAAGCCAAATGCAAAAGGCACATAATCTGGAAGTCAGCAAGCTGTGCCTC
GAGGGCATGAAACTGGCGACCAAGATTGCTTGTCTGTTTGAACTTTCGACACCGAGAGAAGCCTTCATTTCAGCA
TTGAGAAACACAACAAACTTGAACAATCCCCAAGAAATGATGGCAAAGAATATCGAGGCTCTCAAGGTGCTTCTG
GATCTGGGACAAAGCGAGGGCAATTTACTGAGAGAGTCGTGGAAGGACATTCTCCTGTGCATCAGCCAACTGGAT
CGACTACAGCTCATTACAGGCGGCGTCGACGAAAGCGCCATTCCAGACGTGTCCAAAGCACGCTTCGTGCCTCCT
CCCCGGACCGATACCTCAGATTCCAAGTCGTCGACGCAGTCTCGGGCCAAGGCACGGCAAAGAGCTGGAACTGGC
TCACGAGGCTTTTCCAATGAGATTGCGCTGGAGAGTCGATCAGATGAGTTTATTCGCAGCGTCGACCACATCTTT
TCCAACACGGCCAAGCTCTCAGGGGAGGCCATGGTTCACTTTGCAAAGGCTCTGACTGAAGTCAGCTGGGATGAA
ATCAAGGTGTCTGGCTCCAACGAATCTCCGCGTACCTATAGCCTTCAGAAGATTGTGGAAATCAGTTATTACAAC
ATGAATCGAGTCAGGTTTGAGTGGAGCAACATCTGGGACGTGCTGGGCGAGCACTTCAACCAGGTTGGGTGTCAC
AACAATATGAACATTGTCGTCTTTGCCCTAGATTCCCTGCGCCAGCTCTCAATGCGTTTCATGGAGATTGAAGAA
CTGGCTGGTTTCAAATTTCAAAAAGACTTCCTCAAGCCCTTTGAACATGTGCTGTCAAACTCAGACAACATGACA
GTCAAAGACTTGGTTCTGCGGTGCCTCATTCAGATGATCCAGGCTCGGGGAGATAACATTCGTTCTGGCTGGAGA
ACCATGTTTGGAGTCTTTACGGTGGCAGCAAAGGAGCAGCACGAGAGCATTGTCAATCTGGCATACGAAAATGTG
AACCAAGTCTACAAGCAAAAGTTTGGCATCGTCATTTCACAAGGCGCCTTTACGGATCTGGTGGTTTGTTTGACT
GAGTTTTCCAAGAACCTGAAATTTCAAAAGAAGAGTCTGGCAGCGTTGGAGCTACTCAAGTCAATCATTCCTCGC
ATGCTCAAGACGCCCGAGTGTCCGCTCTCGCAGCTCAACTCCAAGCCGTCGGAAGGGTCCAAGAGCCAGGTCAAG
ACATCGGTTGAGGAGGGCTTTTGGTTCCCCGTCTTGTTTGCGTTTCACGACGTGCTCATGACGGGAGAAGACCTC
GAGGTCAGATCAAACGCCCTCGAATACTTCTTTGCGGCACTCGTCAAGCATGGCGGCGACTTTTCGCCCGAGTTT
TGGGACATTTTGTGGCGACAGCAACTCTATCCCATCTTCATGGTGTTGAGGTCGCGGCCCGAGATGAGCAACGCC
CTCAATCACGAGGAGCAGTCTGTCTGGCTTTCAACCACCATGATTCAGGCCCTCCGCAACATGATTACACTCTTC
ACCCACTACTTTGATGCTCTTGAATACATGCTGGACCGGTTTCTGGAATTGTTGGCGCTGTGCATATGCCAGGAA
AACGACACAATTGCTCGCATCGGTAGCAACTGTCTGCAACAGCTCATTCTCAAAAACGTGACCAAATTTACAGCC
GAGCACTGGACCAAGATTGTCGGAGCCTTTTGCGAGCTGTTTGAACGGACAACAGCCTACCAGCTCTTTACGGCC
GCCAACATGGCTTCGTCGACGTCATTGTCGCCCCCATCCAATGGATTCGACCTAACGGGAGTGGCAGGCGTTGAG
CCTCAAATAGTGGATGAAAAGTCGTTGCGCATCAACGGCGGCGAGGACAATGGCACCATGTCGGATGCCGAATCC
ATGCAGCGGCAGCCGTCGCCAAAGCCCGCCGACGACGAGCTCCAAGCATCGCCAGGACATGGCGGCCAGCCACTC
GAAGAGTTCAAGCCATCGTCCAACCTGCAGCAACAGCCTGTGGTTGTGACGTCGGCACGGCGGCGCTTCTTCAAT
CGCATCATCTCACGATGTGTGTTGCAGCTGCTCATGATTGAAACAGTCAATGAGCTCTTCAGCAACGATACTGTG
TATAATCACATCCCATCGACAGAGCTGCTGAGGCTGATGGCGCTGCTTAAACGATCTTTTCAGTTTGCCCGCCGC
TTCAACGAGGATAAGGAACTCCGCATGCGGCTCTGGCGCGAGGGCTTCATGAAGCAGCCGCCCAACCTTCTCAAG
CAGGAGAGCGGCTCGGCTGCCACGTATGTCTCGATTCTCTTTCGCATGTTTGCCGACAAGGCACCCGAGAGGCTC
GAGAGCAGGCCCGATATTGAAGCCGCGCTGGTGCCTCTTTGCAAGGACATCATGACGGGATACTCGGCGCTGGCT
GAGGAGAGCCAGCACCGCAACATCATGGCCTGGCGTCCCGTCGTGGTGGACGTCTTGGAGGGCTATGCCACCTTT
CCCGACGAGGCGTTCAAGGCTCACACGGCCGACTTTTACCCCTTGGCCGTCGACCTCTTGAGTAGAGACCTGGGG
CCGGATTTGCGTGCGGCGCTACTCGTAGTGCTTCGAAGAGTTGGCGAAGTATGCTTGGGTATCGACGGCTTGACC
AAGGCGAGCCAAATTAGGCGCGGAAGCCTCGTCAGTGACGCACATGACGACGCCGCAGCGGATGGAGAAGCGGCT
GCACGAAGAATGCTGTAA
Transcript >OphauG2|2014
ATGAGCTCCCTCAGGTTCGTCGTGTCCTCGCTCGAGGCCATTGCGGCCTCCAAGGATTCCCAGAGGAACAAGCAG
CTGGCCGAGTCGACCAAGCAAGCACTCGACGCCATCAAAGAACAGGACCAGCTGCCCGACCCTGAAATCGTATTT
GCCCCGCTGCAGCTGGCCACCAGGTCCAATAATCCGCAACTGACGACTACGGCCCTCGATTGCATCGGCAAACTC
ATCTCCTACTCATACTTTTCCATCGCCAACAGCCGAGACGAGGCGCCAGAAGAAGGCGCCCAGCCAGCTTCTCCC
TTGATAGAACGCGCCATCGACACAATATGCGATTGCTTCCAGGGCGAGACAACCGCTGTCGAGATTCAGCTGCAG
ATTGTCAAGTCGCTCCTGGCTGCTGTCCTAAACGACAAGATTGTTGTCCACGGCGCCGGCCTCCTCAAAGCCGTC
CGCCAGGTTTACAATGTCTTCCTCCTATCCAGGAGCACCTCTAACCAGCAGGTGGCTCAAGGAACTCTGACCCAG
ATGGTCGGAACTGTCTTTGAGCGCGTCAAGACGAGGCTGCACATGAAGGAAGCCAGGCTCAATTTAGCCAACCTC
AAGCATTCCTCGAGCAACGTCACCTTTGACCCCTCTGAACACTCACAGCCTGTCAGCGCCGATGCAAACGACTCG
TCTGCCTCTGTCCCAGCCCCAGAATCAGAAGTCGGCGCCAAGCTCACACTCAAGGATTTGGAGCATCGCAAGAGC
TTTGACGACTCAAACTTGGGCGATGGCCCGACCATGGTCACCAGACTGGCTCCTGCAAAAAAGGAGAGCGCGGAT
ACCCCGGTCTCGGCTCCCTCGTCGCCTGAAACTCCCAGTCCGTCTGATAGCGATGCCCTCGACGCTGAAGACGAA
GTATATATTCGTGATGCATATCTCGTCTTCCGCTCGTTTTGCAACTTGTCCACCAAGGTGCTACCACCTGACCAG
CTCTTTGATTTGCGCGGCCAACCCATGCGGTCAAAGCTCATCTCCCTTCACATTATTCACACCCTCCTCAATAAC
AACATTGCCGTCTTCACTTCGCCCCTGTGTACCATCAAGAGCTCCAAGAGCAACGAACCGACTTCCTTTCTCCAA
GCCATCAAGTTTTATCTATGTCTTAGCATCACGCGTAATGGTGCCAGTACTGTTGATCGCATTTTTGACGTGTGC
TGCGAGATTTTCTGGCTCATGCTCAAGTACATGCGTCCGTCGTTCAAGAAGGAAATCGAGGTGTTTCTCAACGAG
ATTTACCTGGCCCTCCTATCCCGCCGCAATGCACCTGTGTCGCAGAAGCTTTATTTTGTCACCATTCTCAACAGA
CTTTGTGCTGATCCTCGAGCATTGGTTGAGATTTACCTCAACTATGACTGCGACCAAACTGTTGATAACATTTTT
CAAACCATTGTTGAGGATTTGTCCAAATTTTCCACGACACCAGTCGCCATCACGACAATTAACGAGCAGGTGTAT
GAGGAGCTGCGAGCCAAAACGGCCCCTGCGAGTGAATGGCAACTCAGGGGCATTCTTCCTCCTCCCCTGACGGTG
GCTCAGATTGTGCCACAGGCAGAGAATGAACCCGACTTCCCCAAACATTACGCCATCAAACGCCTGTCCCTAGAG
GCGCTCGTCGAGGCACTAAGATCTTTGCTCAACTGGTCGGCCTCTATCCGCAGTGACAGCGGCGAGGCCCCCAAG
GCCGATGGCGACAATAGGCCCTCGATGGATGAGCTTAGACCGTCTATAGACCCAACGGCCAGCGATAGTGCTTCT
CGTCTGGAAACGCCCTTGCCGCCTTCAACACCTATTATTGACGATGATCCAGAACATCTCGAAAAAGAAAAGGCG
CGCAAGACGGCGCTCACAAATGCCATTGGACAATTCAACTTCAAGCCCAAAAAGGGAATCAAGTTGCTGCTGCGA
GACGGCTTCATACCCAGTAGCAGCCCCAAGGACATTGCAAGCTTTCTCATCAAGGAAGACAAATTGGATAAAGCG
CAGATTGGCGAGTATCTTGGCGAAGGCGATCAGCAAAATATTGACATCATGCACGCCTTTGTCGACTCGATGGAG
TTTGCCAAGAAGCGTTTTGTCGACGCCTTGCGACAGTTTCTGCAGTCTTTCCGACTTCCCGGCGAGGCACAGAAA
ATCGATCGATTCATGCTCAAGTTTGCAGAGCGCTATGTTATGGACAACCCCAACGCGTTTGCCAACGCCGACACG
GCATATGTGCTTGCATACTCGGTGATTATGCTCAACACGGATCAGCACAGTGGCAAGGTTGCCAAGAGAATGAGC
AAAGAAGAATTCATCAAGAACAACCGAGGCATCAATGACAATGCCGACTTGCCTGACGAGTATCTGATCAGCATT
TTTGATGAGATTGCCACCAACGAGATTGTTCTCACAAGTGAGCGTGAAGCCGCCGCCGCTGCCGGAACCTTGTCC
GTACAAGCTACTGGTCTTACGGCCGGTCTCGGCCAAGCCTTTTCCAATGTCGGGCGAGACTTGCAACGCGAGGCC
TATGTCCAGCAATCAGAAGAAATCTCGCTGCGATCAGAACAGCTGTTCAAGAACCTGTTCAAGACTCAGCGCAGA
AACACGGCAAAGACGGGTCCCAAGTTTATTCCAGCCACATCTTCCAAGCACGTTGGCTATATGTTTGACGTGACG
TGGATGTCCTTCTTCTCTGCCCTGTCAAGCCAAATGCAAAAGGCACATAATCTGGAAGTCAGCAAGCTGTGCCTC
GAGGGCATGAAACTGGCGACCAAGATTGCTTGTCTGTTTGAACTTTCGACACCGAGAGAAGCCTTCATTTCAGCA
TTGAGAAACACAACAAACTTGAACAATCCCCAAGAAATGATGGCAAAGAATATCGAGGCTCTCAAGGTGCTTCTG
GATCTGGGACAAAGCGAGGGCAATTTACTGAGAGAGTCGTGGAAGGACATTCTCCTGTGCATCAGCCAACTGGAT
CGACTACAGCTCATTACAGGCGGCGTCGACGAAAGCGCCATTCCAGACGTGTCCAAAGCACGCTTCGTGCCTCCT
CCCCGGACCGATACCTCAGATTCCAAGTCGTCGACGCAGTCTCGGGCCAAGGCACGGCAAAGAGCTGGAACTGGC
TCACGAGGCTTTTCCAATGAGATTGCGCTGGAGAGTCGATCAGATGAGTTTATTCGCAGCGTCGACCACATCTTT
TCCAACACGGCCAAGCTCTCAGGGGAGGCCATGGTTCACTTTGCAAAGGCTCTGACTGAAGTCAGCTGGGATGAA
ATCAAGGTGTCTGGCTCCAACGAATCTCCGCGTACCTATAGCCTTCAGAAGATTGTGGAAATCAGTTATTACAAC
ATGAATCGAGTCAGGTTTGAGTGGAGCAACATCTGGGACGTGCTGGGCGAGCACTTCAACCAGGTTGGGTGTCAC
AACAATATGAACATTGTCGTCTTTGCCCTAGATTCCCTGCGCCAGCTCTCAATGCGTTTCATGGAGATTGAAGAA
CTGGCTGGTTTCAAATTTCAAAAAGACTTCCTCAAGCCCTTTGAACATGTGCTGTCAAACTCAGACAACATGACA
GTCAAAGACTTGGTTCTGCGGTGCCTCATTCAGATGATCCAGGCTCGGGGAGATAACATTCGTTCTGGCTGGAGA
ACCATGTTTGGAGTCTTTACGGTGGCAGCAAAGGAGCAGCACGAGAGCATTGTCAATCTGGCATACGAAAATGTG
AACCAAGTCTACAAGCAAAAGTTTGGCATCGTCATTTCACAAGGCGCCTTTACGGATCTGGTGGTTTGTTTGACT
GAGTTTTCCAAGAACCTGAAATTTCAAAAGAAGAGTCTGGCAGCGTTGGAGCTACTCAAGTCAATCATTCCTCGC
ATGCTCAAGACGCCCGAGTGTCCGCTCTCGCAGCTCAACTCCAAGCCGTCGGAAGGGTCCAAGAGCCAGGTCAAG
ACATCGGTTGAGGAGGGCTTTTGGTTCCCCGTCTTGTTTGCGTTTCACGACGTGCTCATGACGGGAGAAGACCTC
GAGGTCAGATCAAACGCCCTCGAATACTTCTTTGCGGCACTCGTCAAGCATGGCGGCGACTTTTCGCCCGAGTTT
TGGGACATTTTGTGGCGACAGCAACTCTATCCCATCTTCATGGTGTTGAGGTCGCGGCCCGAGATGAGCAACGCC
CTCAATCACGAGGAGCAGTCTGTCTGGCTTTCAACCACCATGATTCAGGCCCTCCGCAACATGATTACACTCTTC
ACCCACTACTTTGATGCTCTTGAATACATGCTGGACCGGTTTCTGGAATTGTTGGCGCTGTGCATATGCCAGGAA
AACGACACAATTGCTCGCATCGGTAGCAACTGTCTGCAACAGCTCATTCTCAAAAACGTGACCAAATTTACAGCC
GAGCACTGGACCAAGATTGTCGGAGCCTTTTGCGAGCTGTTTGAACGGACAACAGCCTACCAGCTCTTTACGGCC
GCCAACATGGCTTCGTCGACGTCATTGTCGCCCCCATCCAATGGATTCGACCTAACGGGAGTGGCAGGCGTTGAG
CCTCAAATAGTGGATGAAAAGTCGTTGCGCATCAACGGCGGCGAGGACAATGGCACCATGTCGGATGCCGAATCC
ATGCAGCGGCAGCCGTCGCCAAAGCCCGCCGACGACGAGCTCCAAGCATCGCCAGGACATGGCGGCCAGCCACTC
GAAGAGTTCAAGCCATCGTCCAACCTGCAGCAACAGCCTGTGGTTGTGACGTCGGCACGGCGGCGCTTCTTCAAT
CGCATCATCTCACGATGTGTGTTGCAGCTGCTCATGATTGAAACAGTCAATGAGCTCTTCAGCAACGATACTGTG
TATAATCACATCCCATCGACAGAGCTGCTGAGGCTGATGGCGCTGCTTAAACGATCTTTTCAGTTTGCCCGCCGC
TTCAACGAGGATAAGGAACTCCGCATGCGGCTCTGGCGCGAGGGCTTCATGAAGCAGCCGCCCAACCTTCTCAAG
CAGGAGAGCGGCTCGGCTGCCACGTATGTCTCGATTCTCTTTCGCATGTTTGCCGACAAGGCACCCGAGAGGCTC
GAGAGCAGGCCCGATATTGAAGCCGCGCTGGTGCCTCTTTGCAAGGACATCATGACGGGATACTCGGCGCTGGCT
GAGGAGAGCCAGCACCGCAACATCATGGCCTGGCGTCCCGTCGTGGTGGACGTCTTGGAGGGCTATGCCACCTTT
CCCGACGAGGCGTTCAAGGCTCACACGGCCGACTTTTACCCCTTGGCCGTCGACCTCTTGAGTAGAGACCTGGGG
CCGGATTTGCGTGCGGCGCTACTCGTAGTGCTTCGAAGAGTTGGCGAAGTATGCTTGGGTATCGACGGCTTGACC
AAGGCGAGCCAAATTAGGCGCGGAAGCCTCGTCAGTGACGCACATGACGACGCCGCAGCGGATGGAGAAGCGGCT
GCACGAAGAATGCTGTAA
Gene >OphauG2|2014
ATGAGCTCCCTCAGGTTCGTCGTGTCCTCGCTCGAGGCCATTGCGGCCTCCAAGGATTCCCAGAGGAACAAGCAG
CTGGCCGAGTCGACCAAGCAAGCACTCGACGCCATCAAAGAACAGGACCAGCTGCCCGACCCTGAAATCGTATTT
GCCCCGCTGCAGCTGGCCACCAGGTCCAATAATCCGCAACTGACGACTACGGCCCTCGATTGCATCGGCAAACTC
ATCTCCTACTCATACTTTTCCATCGCCAACAGCCGAGACGAGGCGCCAGAAGAAGGCGCCCAGCCAGCTTCTCCC
TTGATAGAACGCGCCATCGACACAATATGCGATTGCTTCCAGGGCGAGACAACCGCTGTCGAGATTCAGCTGCAG
ATTGTCAAGTCGCTCCTGGCTGCTGTCCTAAACGACAAGATTGTTGTCCACGGCGCCGGCCTCCTCAAAGCCGTC
CGCCAGGTTTACAATGTCTTCCTCCTATCCAGGAGCACCTCTAACCAGCAGGTGGCTCAAGGAACTCTGACCCAG
ATGGTCGGAACTGTCTTTGAGCGCGTCAAGACGAGGCTGCACATGAAGGAAGCCAGGCTCAATTTAGCCAACCTC
AAGCATTCCTCGAGCAACGTCACCTTTGACCCCTCTGAACACTCACAGCCTGTCAGCGCCGATGCAAACGACTCG
TCTGCCTCTGTCCCAGCCCCAGAATCAGAAGTCGGCGCCAAGCTCACACTCAAGGATTTGGAGCATCGCAAGAGC
TTTGACGACTCAAACTTGGGCGATGGCCCGACCATGGTCACCAGACTGGCTCCTGCAAAAAAGGAGAGCGCGGAT
ACCCCGGTCTCGGCTCCCTCGTCGCCTGAAACTCCCAGTCCGTCTGATAGCGATGCCCTCGACGCTGAAGACGAA
GTATATATTCGTGATGCATATCTCGTCTTCCGCTCGTTTTGCAACTTGTCCACCAAGGTGCTACCACCTGACCAG
CTCTTTGATTTGCGCGGCCAACCCATGCGGTCAAAGCTCATCTCCCTTCACATTATTCACACCCTCCTCAATAAC
AACATTGCCGTCTTCACTTCGCCCCTGTGTACCATCAAGAGCTCCAAGAGCAACGAACCGACTTCCTTTCTCCAA
GCCATCAAGTTTTATCTATGTCTTAGCATCACGCGTAATGGTGCCAGTACTGTTGATCGCATTTTTGACGTGTGC
TGCGAGATTTTCTGGCTCATGCTCAAGTACATGCGTCCGTCGTTCAAGGCAAGTTCTCGCCAATCGACTTGATCT
CCTTGCGCTCACCCCAGCTACAGAAGGAAATCGAGGTGTTTCTCAACGAGATTTACCTGGCCCTCCTATCCCGCC
GCAATGCACCTGTGTCGCAGAAGCTTTATTTTGTCACCATTCTCAACAGACTTTGTGCTGATCCTCGAGCATTGG
TTGAGATTTACCTCAACTATGACTGCGACCAAACTGTTGATAACATTTTTCAAACCATTGTTGAGGATTTGTCCA
AATTTTCCACGACACCAGTCGCCATCACGACAATTAACGAGCAGGTGTATGAGGAGCTGCGAGCCAAAACGGCCC
CTGCGAGTGAATGGCAACTCAGGGGCATTCTTCCTCCTCCCCTGACGGTGGCTCAGATTGTGCCACAGGCAGAGA
ATGAACCCGACTTCCCCAAACATTACGCCATCAAACGCCTGTCCCTAGAGGCGCTCGTCGAGGCACTAAGATCTT
TGCTCAACTGGTCGGCCTCTATCCGCAGTGACAGCGGCGAGGCCCCCAAGGCCGATGGCGACAATAGGCCCTCGA
TGGATGAGCTTAGACCGTCTATAGACCCAACGGCCAGCGATAGTGCTTCTCGTCTGGAAACGCCCTTGCCGCCTT
CAACACCTATTATTGACGATGATCCAGAACATCTCGAAAAAGAAAAGGCGCGCAAGACGGCGCTCACAAATGCCA
TTGGACAATTCAACTTCAAGCCCAAAAAGGGAATCAAGTTGCTGCTGCGAGACGGCTTCATACCCAGTAGCAGCC
CCAAGGACATTGCAAGCTTTCTCATCAAGGAAGACAAATTGGATAAAGCGCAGATTGGCGAGTATCTTGGCGAAG
GCGATCAGCAAAATATTGACATCATGCACGCCTTTGTCGACTCGATGGAGTTTGCCAAGAAGCGTTTTGTCGACG
CCTTGCGACAGTTTCTGCAGTCTTTCCGACTTCCCGGCGAGGCACAGAAAATCGATCGATTCATGCTCAAGTTTG
CAGAGCGCTATGTTATGGACAACCCCAACGCGTTTGCCAACGCCGACACGGCATATGTGCTTGCATACTCGGTGA
TTATGCTCAACACGGATCAGCACAGTGGCAAGGTTGCCAAGAGAATGAGCAAAGAAGAATTCATCAAGAACAACC
GAGGCATCAATGACAATGCCGACTTGCCTGACGAGTATCTGATCAGCATTTTTGATGAGATTGCCACCAACGAGA
TTGTTCTCACAAGTGAGCGTGAAGCCGCCGCCGCTGCCGGAACCTTGTCCGTACAAGCTACTGGTCTTACGGCCG
GTCTCGGCCAAGCCTTTTCCAATGTCGGGCGAGACTTGCAACGCGAGGCCTATGTCCAGCAATCAGAAGAAATCT
CGCTGCGATCAGAACAGCTGTTCAAGAACCTGTTCAAGACTCAGCGCAGAAACACGGCAAAGACGGGTCCCAAGT
TTATTCCAGCCACATCTTCCAAGCACGTTGGCTATATGTTTGACGTGACGTGGATGTCCTTCTTCTCTGCCCTGT
CAAGCCAAATGCAAAAGGCACATAATCTGGAAGTCAGCAAGCTGTGCCTCGAGGGCATGAAACTGGCGACCAAGA
TTGCTTGTCTGTTTGAACTTTCGACACCGAGAGAAGCCTTCATTTCAGCATTGAGAAACACAACAAACTTGAACA
ATCCCCAAGAAATGATGGCAAAGAATATCGAGGCTCTCAAGGTGCTTCTGGATCTGGGACAAAGCGAGGGCAATT
TACTGAGAGAGTCGTGGAAGGACATTCTCCTGTGCATCAGCCAACTGGATCGACTACAGCTCATTACAGGCGGCG
TCGACGAAAGCGCCATTCCAGACGTGTCCAAAGCACGCTTCGTGCCTCCTCCCCGGACCGATACCTCAGATTCCA
AGTCGTCGACGCAGTCTCGGGCCAAGGCACGGCAAAGAGCTGGAACTGGCTCACGAGGCTTTTCCAATGAGATTG
CGCTGGAGAGTCGATCAGATGAGTTTATTCGCAGCGTCGACCACATCTTTTCCAACACGGCCAAGCTCTCAGGGG
AGGCCATGGTTCACTTTGCAAAGGCTCTGACTGAAGTCAGCTGGGATGAAATCAAGGTGTCTGGCTCCAACGAAT
CTCCGCGTACCTATAGCCTTCAGAAGATTGTGGAAATCAGTTATTACAACATGAATCGAGTCAGGTTTGAGTGGA
GCAACATCTGGGACGTGCTGGGCGAGCACTTCAACCAGGTTGGGTGTCACAACAATATGAACATTGTCGTCTTTG
CCCTAGATTCCCTGCGCCAGCTCTCAATGCGTTTCATGGAGATTGAAGAACTGGCTGGTTTCAAATTTCAAAAAG
ACTTCCTCAAGCCCTTTGAACATGTGCTGTCAAACTCAGACAACATGACAGTCAAAGACTTGGTTCTGCGGTGCC
TCATTCAGATGATCCAGGCTCGGGGAGATAACATTCGTTCTGGCTGGAGAACCATGTTTGGAGTCTTTACGGTGG
CAGCAAAGGAGCAGCACGAGAGCATTGTCAATCTGGCATACGAAAATGTGAACCAAGTCTACAAGCAAAAGTTTG
GCATCGTCATTTCACAAGGCGCCTTTACGGATCTGGTGGTTTGTTTGACTGAGTTTTCCAAGAACCTGAAATTTC
AAAAGAAGAGTCTGGCAGCGTTGGAGCTACTCAAGTCAATCATTCCTCGCATGCTCAAGACGCCCGAGTGTCCGC
TCTCGCAGCTCAACTCCAAGCCGTCGGAAGGGTCCAAGAGCCAGGTCAAGACATCGGTTGAGGAGGGCTTTTGGT
TCCCCGTCTTGTTTGCGTTTCACGACGTGCTCATGACGGGAGAAGACCTCGAGGTCAGATCAAACGCCCTCGAAT
ACTTCTTTGCGGCACTCGTCAAGCATGGCGGCGACTTTTCGCCCGAGTTTTGGGACATTTTGTGGCGACAGCAAC
TCTATCCCATCTTCATGGTGTTGAGGTCGCGGCCCGAGATGAGCAACGCCCTCAATCACGAGGAGCAGTCTGTCT
GGCTTTCAACCACCATGATTCAGGCCCTCCGCAACATGATTACACTCTTCACCCACTACTTTGATGCTCTTGAAT
ACATGCTGGACCGGTTTCTGGAATTGTTGGCGCTGTGCATATGCCAGGAAAACGACACAATTGCTCGCATCGGTA
GCAACTGTCTGCAACAGCTCATTCTCAAAAACGTGACCAAATTTACAGCCGAGCACTGGACCAAGATTGTCGGAG
CCTTTTGCGAGCTGTTTGAACGGACAACAGCCTACCAGCTCTTTACGGCCGCCAACATGGCTTCGTCGACGTCAT
TGTCGCCCCCATCCAATGGATTCGACCTAACGGGAGTGGCAGGCGTTGAGCCTCAAATAGTGGATGAAAAGTCGT
TGCGCATCAACGGCGGCGAGGACAATGGCACCATGTCGGATGCCGAATCCATGCAGCGGCAGCCGTCGCCAAAGC
CCGCCGACGACGAGCTCCAAGCATCGCCAGGACATGGCGGCCAGCCACTCGAAGAGTTCAAGCCATCGTCCAACC
TGCAGCAACAGCCTGTGGTTGTGACGTCGGCACGGCGGCGCTTCTTCAATCGCATCATCTCACGATGTGTGTTGC
AGCTGCTCATGATTGAAACAGTCAATGAGCTCTTCAGCAACGATACTGTGTATAATCACATCCCATCGACAGAGC
TGCTGAGGCTGATGGCGCTGCTTAAACGATCTTTTCAGTTTGCCCGCCGCTTCAACGAGGATAAGGAACTCCGCA
TGCGGCTCTGGCGCGAGGGCTTCATGAAGCAGCCGCCCAACCTTCTCAAGCAGGAGAGCGGCTCGGCTGCCACGT
ATGTCTCGATTCTCTTTCGCATGTTTGCCGACAAGGCACCCGAGAGGCTCGAGAGCAGGCCCGATATTGAAGCCG
CGCTGGTGCCTCTTTGCAAGGACATCATGACGGGATACTCGGCGCTGGCTGAGGAGAGCCAGCACCGCAACATCA
TGGCCTGGCGTCCCGTCGTGGTGGACGTCTTGGAGGGCTATGCCACCTTTCCCGACGAGGCGTTCAAGGCTCACA
CGGCCGACTTTTACCCCTTGGCCGTCGACCTCTTGAGTAGAGACCTGGGGCCGGATTTGCGTGCGGCGCTACTCG
TAGTGCTTCGAAGAGTTGGCGAAGTATGCTTGGGTATCGACGGCTTGACCAAGGCGAGCCAAATTAGGCGCGGAA
GCCTCGTCAGTGACGCACATGACGACGCCGCAGCGGATGGAGAAGCGGCTGCACGAAGAATGCTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail