Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2009
Gene name
LocationContig_1669:90..1934
Strand+
Gene length (bp)1844
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09779 Ima1_N Ima1 N-terminal domain 1.0E-24 10 130

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13681|IINMP_SCHPO Integral inner nuclear membrane protein ima1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=IMA1 PE=4 SV=2 10 405 3.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 191 213 22
2 248 267 19
3 282 299 17
4 536 558 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2009
MVSFRASGQLACFYCGQQSSSQAAPGRKHSFVCGHCDATNYLDADGGIMDPPVATERESAPKRYVARGAGGGDET
VFCSRCLENQHLFTRCLAQYSNNREDFVLNREYYSFRKQQEQRYPQVCDACAVKVQQRILRAGYTAKTDHLRRMM
DMSRGKRIMTTEPTRLDYVSAIGRATWRAGFVLEMLWHAKAVVFVLANSMPLSAALVDLLAYLPATHRLASWSIA
AAFASAWWNPHFVQVNRGFTRHLLGLTQWYCFQGLIIFFRLASRGLLSMNQSKDACLSAHLAMAVVMMLMHVYAH
KSIRVDTSMLFSWNNASSIPPPSPRTAKENDCKTFSQLVDETLESASPQSQARHRGTAATGHRVAVHTPVHRRPR
APEPDEMDWSPMAAPHRALLNQHNATRNAPDLGANPFRYPVPPAPFNPANRAWGRPLEAQEPQQSIPPAKASLEF
GRHGNPVWQPSVSSHAGVEFKPPSFFAQPSMDDDNSLAALLDRSFTISQPHGHDSGEETEVEDRVQQVSARIPGI
RLPAARKKQKLLCGVLSYEWLLLMVMLGTWMLSTPRRAMGST*
Coding >OphauG2|2009
ATGGTGAGCTTCCGCGCGTCGGGGCAGCTGGCCTGCTTTTACTGCGGGCAGCAGTCGTCAAGCCAAGCAGCACCA
GGGCGCAAGCACAGCTTTGTGTGCGGGCACTGCGATGCGACCAACTACCTAGACGCAGACGGCGGCATCATGGAC
CCGCCTGTTGCGACGGAGCGAGAAAGCGCGCCAAAGCGATATGTTGCTCGTGGGGCGGGCGGGGGAGACGAGACG
GTGTTTTGCTCAAGGTGCCTGGAGAACCAGCATCTGTTTACGCGGTGTCTTGCGCAGTACTCAAACAACCGCGAG
GACTTTGTGCTGAATCGCGAATACTATAGCTTCCGCAAACAACAGGAGCAGCGCTATCCCCAGGTGTGCGACGCG
TGTGCCGTCAAGGTGCAGCAGCGCATCCTCAGGGCGGGCTACACGGCCAAGACGGACCACCTGCGCCGCATGATG
GACATGAGCCGCGGCAAACGCATCATGACGACGGAACCCACACGCCTCGACTACGTCAGTGCCATTGGGCGCGCC
ACCTGGCGAGCTGGCTTTGTGCTTGAGATGCTGTGGCATGCCAAGGCTGTTGTCTTTGTCTTGGCCAACTCGATG
CCGCTTTCTGCCGCCCTTGTCGACCTCTTGGCCTATCTGCCTGCTACACACCGCCTTGCTAGCTGGAGCATTGCT
GCCGCCTTTGCTTCTGCTTGGTGGAATCCGCATTTTGTCCAGGTCAACCGCGGCTTCACCAGGCATCTTTTGGGC
CTGACGCAATGGTACTGCTTCCAGGGCCTCATCATCTTTTTCCGCCTGGCCTCGCGCGGCCTGCTCAGCATGAAT
CAATCCAAAGACGCCTGCCTAAGTGCTCATTTGGCCATGGCAGTCGTCATGATGCTGATGCATGTCTACGCCCAC
AAGTCGATTCGCGTCGACACCTCGATGCTCTTTTCCTGGAACAATGCCTCGTCGATTCCTCCGCCCTCTCCCCGC
ACCGCCAAGGAGAATGACTGCAAGACCTTTTCGCAGCTTGTTGACGAAACGCTCGAGTCGGCCAGTCCACAGTCC
CAAGCCCGCCACCGTGGCACTGCTGCGACTGGGCATCGTGTTGCCGTCCACACTCCAGTCCATCGTCGGCCTCGG
GCCCCAGAACCGGACGAGATGGACTGGTCGCCCATGGCCGCGCCGCACCGCGCCTTGTTGAACCAGCACAATGCG
ACAAGAAACGCGCCCGACCTGGGGGCCAACCCTTTTCGATACCCCGTGCCGCCCGCACCCTTCAACCCGGCCAAC
CGTGCCTGGGGGAGGCCGTTGGAAGCACAGGAGCCACAGCAAAGCATCCCCCCGGCAAAGGCCAGCCTTGAATTC
GGCAGACACGGCAACCCTGTGTGGCAGCCATCCGTCTCGTCGCATGCCGGCGTGGAGTTCAAGCCACCGTCGTTT
TTTGCGCAGCCAAGCATGGACGACGACAACTCGCTGGCCGCGCTGCTGGACCGCAGCTTCACCATCAGCCAGCCG
CATGGCCACGACTCGGGAGAAGAGACCGAGGTGGAGGACCGAGTCCAGCAAGTGTCTGCGCGAATACCAGGCATA
CGTTTGCCTGCTGCCAGGAAGAAGCAGAAGCTGTTGTGTGGCGTCTTGTCGTACGAGTGGCTACTGCTGATGGTG
ATGCTGGGCACTTGGATGCTCAGCACGCCGAGACGCGCAATGGGATCTACTTGA
Transcript >OphauG2|2009
ATGGTGAGCTTCCGCGCGTCGGGGCAGCTGGCCTGCTTTTACTGCGGGCAGCAGTCGTCAAGCCAAGCAGCACCA
GGGCGCAAGCACAGCTTTGTGTGCGGGCACTGCGATGCGACCAACTACCTAGACGCAGACGGCGGCATCATGGAC
CCGCCTGTTGCGACGGAGCGAGAAAGCGCGCCAAAGCGATATGTTGCTCGTGGGGCGGGCGGGGGAGACGAGACG
GTGTTTTGCTCAAGGTGCCTGGAGAACCAGCATCTGTTTACGCGGTGTCTTGCGCAGTACTCAAACAACCGCGAG
GACTTTGTGCTGAATCGCGAATACTATAGCTTCCGCAAACAACAGGAGCAGCGCTATCCCCAGGTGTGCGACGCG
TGTGCCGTCAAGGTGCAGCAGCGCATCCTCAGGGCGGGCTACACGGCCAAGACGGACCACCTGCGCCGCATGATG
GACATGAGCCGCGGCAAACGCATCATGACGACGGAACCCACACGCCTCGACTACGTCAGTGCCATTGGGCGCGCC
ACCTGGCGAGCTGGCTTTGTGCTTGAGATGCTGTGGCATGCCAAGGCTGTTGTCTTTGTCTTGGCCAACTCGATG
CCGCTTTCTGCCGCCCTTGTCGACCTCTTGGCCTATCTGCCTGCTACACACCGCCTTGCTAGCTGGAGCATTGCT
GCCGCCTTTGCTTCTGCTTGGTGGAATCCGCATTTTGTCCAGGTCAACCGCGGCTTCACCAGGCATCTTTTGGGC
CTGACGCAATGGTACTGCTTCCAGGGCCTCATCATCTTTTTCCGCCTGGCCTCGCGCGGCCTGCTCAGCATGAAT
CAATCCAAAGACGCCTGCCTAAGTGCTCATTTGGCCATGGCAGTCGTCATGATGCTGATGCATGTCTACGCCCAC
AAGTCGATTCGCGTCGACACCTCGATGCTCTTTTCCTGGAACAATGCCTCGTCGATTCCTCCGCCCTCTCCCCGC
ACCGCCAAGGAGAATGACTGCAAGACCTTTTCGCAGCTTGTTGACGAAACGCTCGAGTCGGCCAGTCCACAGTCC
CAAGCCCGCCACCGTGGCACTGCTGCGACTGGGCATCGTGTTGCCGTCCACACTCCAGTCCATCGTCGGCCTCGG
GCCCCAGAACCGGACGAGATGGACTGGTCGCCCATGGCCGCGCCGCACCGCGCCTTGTTGAACCAGCACAATGCG
ACAAGAAACGCGCCCGACCTGGGGGCCAACCCTTTTCGATACCCCGTGCCGCCCGCACCCTTCAACCCGGCCAAC
CGTGCCTGGGGGAGGCCGTTGGAAGCACAGGAGCCACAGCAAAGCATCCCCCCGGCAAAGGCCAGCCTTGAATTC
GGCAGACACGGCAACCCTGTGTGGCAGCCATCCGTCTCGTCGCATGCCGGCGTGGAGTTCAAGCCACCGTCGTTT
TTTGCGCAGCCAAGCATGGACGACGACAACTCGCTGGCCGCGCTGCTGGACCGCAGCTTCACCATCAGCCAGCCG
CATGGCCACGACTCGGGAGAAGAGACCGAGGTGGAGGACCGAGTCCAGCAAGTGTCTGCGCGAATACCAGGCATA
CGTTTGCCTGCTGCCAGGAAGAAGCAGAAGCTGTTGTGTGGCGTCTTGTCGTACGAGTGGCTACTGCTGATGGTG
ATGCTGGGCACTTGGATGCTCAGCACGCCGAGACGCGCAATGGGATCTACTTGA
Gene >OphauG2|2009
ATGGTGAGCTTCCGCGCGTCGGGGCAGCTGGCCTGCTTTTACTGCGGGCAGCAGTCGTCAAGCCAAGCAGCACCA
GGGCGCAAGCACAGCTTTGTGTGCGGGCACTGCGATGCGACCAACTACCTAGACGCAGACGGCGGCATCATGGAC
CCGCCTGTTGCGACGGAGCGAGAAAGCGCGCCAAAGCGATATGTTGCTCGTGGGGCGGGCGGGGGAGACGAGACG
GTGTTTTGCTCAAGGTGCCTGGAGAACCAGCATCTGTTTACGCGGTGTCTTGCGCAGTACTCAAACAACCGCGAG
GACTTTGTGCTGAATCGCGAATACTATAGCTTCCGCAAACAACAGGAGCAGCGCTATCCCCAGGTGTGCGACGCG
TGTGCCGTCAAGGTGCAGCAGCGCATCCTCAGGGCGGGCTACACGGCCAAGACGGACCACCTGCGCCGCATGATG
GACATGAGCCGCGGCAAACGCATCATGACGACGGAACCCACACGCCTCGACTACGTCAGTGCCATTGGGCGCGCC
ACCTGGCGAGCTGGCTTTGTGCTTGAGATGCTGTGGCATGCCAAGGCTGTTGTCTTTGTCTTGGCCAACTCGATG
CCGCTTTCTGCCGCCCTTGTCGACCTCTTGGCCTATCTGCCTGCTACACACCGCCTTGCTAGCTGGAGCATTGCT
GCCGCCTTTGCTTCTGCTTGGTGGAATCCGCATTTTGTCCAGGTCAACCGCGGCTTCACCAGGCATCTTTTGGGC
CTGACGCAATGGTACTGCTTCCAGGGCCTCATCATCTTTTTCCGCCTGGCCTCGCGCGGCCTGCTCAGCATGAAT
CAATCCAAAGACGCCTGCCTAAGTGCTCATTTGGCCATGGCAGTCGTCATGATGCTGGTGAGTGGTGCCGCCTCC
AAGCCCCGAGTCGATGCTGACGCACGCGCAACAAAGATGCATGTCTACGCCCACAAGTCGATTCGCGTCGACACC
TCGATGCTCTTTTCCTGGAACAATGCCTCGTCGATTCCTCCGCCCTCTCCCCGCACCGCCAAGGAGAATGACTGC
AAGACCTTTTCGCAGCTTGTTGACGAAACGCTCGAGTCGGCCAGTCCACAGTCCCAAGCCCGCCACCGTGGCACT
GCTGCGACTGGGCATCGTGTTGCCGTCCACACTCCAGTCCATCGTCGGCCTCGGGCCCCAGAACCGGACGAGATG
GACTGGTCGCCCATGGCCGCGCCGCACCGCGCCTTGTTGAACCAGCACAATGCGACAAGAAACGCGCCCGACCTG
GGGGCCAACCCTTTTCGATACCCCGTGCCGCCCGCACCCTTCAACCCGGCCAACCGTGCCTGGGGGAGGCCGTTG
GAAGCACAGGAGCCACAGCAAAGCATCCCCCCGGCAAAGGCCAGCCTTGAATTCGGCAGACACGGCAACCCTGTG
TGGCAGCCATCCGTCTCGTCGCATGCCGGCGTGGAGTTCAAGCCACCGTCGTTTTTTGCGCAGCCAAGCATGGAC
GACGACAACTCGCTGGCCGCGCTGCTGGACCGCAGCTTCACCATCAGCCAGCCGCATGGCCACGACTCGGGAGAA
GAGACCGAGGTGGAGGACCGAGTCCAGCAAGTGTCTGCGCGAATACCAGGCATACGTTTGCCTGCTGCCAGGAAG
AAGCAGAAGCTGTTGTGTGGCGTCTTGTCGTACGAGTGGCTACTGCTGATGGTGATGCTGGGCACTTGGATGCTC
AGCACGGTTTGGACAAGGCACGCACACACTGTGCAGCCGGGGCTCATGGCCGTTGCGGGCATCATGTCGCTGCGC
GACGCGGGACATCGCAGCCGAGACGCGCAATGGGATCTACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail