Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|2004
Gene name
LocationContig_1664:295..1864
Strand+
Gene length (bp)1569
Transcript length (bp)1320
Coding sequence length (bp)1320
Protein length (aa) 440

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4621
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2004 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5453
Ophiocordyceps camponoti-floridani Ophcf2|04643
Ophiocordyceps camponoti-rufipedis Ophun1|6132
Ophiocordyceps kimflemingae Ophio5|6712
Ophiocordyceps subramaniannii Hirsu2|97

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|2004
MAPELNLGFDVDSSLGSEASPDSLDQDTDGVGVLDGDAGGQVAEPFSLADLMTGDNGVHNVWDPLSLRGYSDYDN
DKVDFDLHTMPSMACAFGSQPQPQPQPQSQPQHHHQPHHQPQRQPQPVRDVEVFKSIKTMGVDVDAVQANDPNSR
TGSIVAFFTSLGSKFSQTRALPFIHERLWFSHSPAAPASNDSCLPLPSNPGTSGPPPMMLAAFSAAAAYSSRTSQ
TTPWALRIVAEAARDVLKQGERAASHAERLARVQALTVLSVMCFFDGDIGLRAAAERGLATLLAWVKDLESVRNQ
LEAEARERSQLGLSMRDAPPQTWESWIFLESTRRSVTMGYAYICLSHLLKSEEPRSDMWSDQQNFTASRHLWDAK
SSVEFYRAWREKPHYLIENLSFNEFWVYGRPADIDEFTRLMLTGQIGPDAMHHFMHGDIAVPVV*
Coding >OphauG2|2004
ATGGCTCCTGAGCTGAATCTTGGCTTCGACGTGGACAGCAGCCTAGGATCCGAAGCCAGCCCGGACAGCCTGGAC
CAGGATACAGACGGTGTTGGGGTGCTCGATGGAGACGCAGGCGGACAAGTCGCCGAGCCCTTTTCCTTGGCCGAC
TTGATGACCGGTGACAATGGCGTCCATAATGTTTGGGATCCCCTGAGCCTCAGGGGCTATAGCGACTATGACAAT
GACAAGGTGGACTTTGACCTGCACACGATGCCATCCATGGCATGCGCCTTTGGCTCGCAGCCTCAACCCCAGCCT
CAACCCCAGTCTCAACCCCAACACCATCACCAGCCCCATCACCAGCCCCAGCGTCAGCCTCAACCAGTCCGCGAT
GTGGAAGTCTTCAAGTCCATCAAAACCATGGGGGTCGACGTCGACGCGGTCCAGGCCAATGACCCCAATTCACGC
ACCGGGTCCATAGTGGCCTTTTTCACCTCGCTAGGCTCCAAATTTAGCCAGACGCGAGCCTTGCCCTTTATACAC
GAGCGGCTCTGGTTCTCGCATTCCCCAGCAGCGCCGGCTTCTAATGATTCATGTCTGCCCCTGCCCAGCAATCCC
GGCACCAGCGGGCCTCCGCCCATGATGCTGGCTGCCTTTTCGGCAGCTGCTGCATACAGTTCGCGCACGTCCCAG
ACAACTCCCTGGGCACTGCGAATTGTCGCCGAAGCGGCCCGGGATGTGCTCAAGCAGGGCGAGCGAGCGGCAAGC
CATGCAGAACGGCTGGCGCGTGTGCAGGCGCTGACGGTGCTGAGTGTCATGTGCTTTTTTGATGGGGATATCGGC
TTGCGAGCCGCCGCGGAGCGTGGCCTTGCCACTCTGCTGGCATGGGTCAAGGACCTGGAAAGCGTCAGGAACCAA
CTCGAGGCTGAGGCGCGAGAGCGCTCTCAACTTGGCCTCTCCATGAGGGATGCGCCGCCACAGACTTGGGAGAGC
TGGATTTTCCTCGAGAGCACGCGGCGTAGCGTCACCATGGGCTATGCATACATATGCCTCAGCCATCTGCTCAAG
TCAGAAGAGCCAAGAAGCGACATGTGGAGCGACCAACAGAACTTTACAGCCTCACGGCACCTCTGGGATGCCAAA
AGCTCTGTCGAATTTTATCGGGCGTGGAGAGAAAAGCCGCACTATCTGATTGAAAACTTGTCCTTCAATGAATTC
TGGGTATACGGCCGGCCGGCCGATATTGACGAGTTTACAAGGCTGATGCTTACGGGGCAAATCGGTCCAGACGCC
ATGCATCATTTTATGCACGGAGACATAGCGGTTCCCGTGGTATGA
Transcript >OphauG2|2004
ATGGCTCCTGAGCTGAATCTTGGCTTCGACGTGGACAGCAGCCTAGGATCCGAAGCCAGCCCGGACAGCCTGGAC
CAGGATACAGACGGTGTTGGGGTGCTCGATGGAGACGCAGGCGGACAAGTCGCCGAGCCCTTTTCCTTGGCCGAC
TTGATGACCGGTGACAATGGCGTCCATAATGTTTGGGATCCCCTGAGCCTCAGGGGCTATAGCGACTATGACAAT
GACAAGGTGGACTTTGACCTGCACACGATGCCATCCATGGCATGCGCCTTTGGCTCGCAGCCTCAACCCCAGCCT
CAACCCCAGTCTCAACCCCAACACCATCACCAGCCCCATCACCAGCCCCAGCGTCAGCCTCAACCAGTCCGCGAT
GTGGAAGTCTTCAAGTCCATCAAAACCATGGGGGTCGACGTCGACGCGGTCCAGGCCAATGACCCCAATTCACGC
ACCGGGTCCATAGTGGCCTTTTTCACCTCGCTAGGCTCCAAATTTAGCCAGACGCGAGCCTTGCCCTTTATACAC
GAGCGGCTCTGGTTCTCGCATTCCCCAGCAGCGCCGGCTTCTAATGATTCATGTCTGCCCCTGCCCAGCAATCCC
GGCACCAGCGGGCCTCCGCCCATGATGCTGGCTGCCTTTTCGGCAGCTGCTGCATACAGTTCGCGCACGTCCCAG
ACAACTCCCTGGGCACTGCGAATTGTCGCCGAAGCGGCCCGGGATGTGCTCAAGCAGGGCGAGCGAGCGGCAAGC
CATGCAGAACGGCTGGCGCGTGTGCAGGCGCTGACGGTGCTGAGTGTCATGTGCTTTTTTGATGGGGATATCGGC
TTGCGAGCCGCCGCGGAGCGTGGCCTTGCCACTCTGCTGGCATGGGTCAAGGACCTGGAAAGCGTCAGGAACCAA
CTCGAGGCTGAGGCGCGAGAGCGCTCTCAACTTGGCCTCTCCATGAGGGATGCGCCGCCACAGACTTGGGAGAGC
TGGATTTTCCTCGAGAGCACGCGGCGTAGCGTCACCATGGGCTATGCATACATATGCCTCAGCCATCTGCTCAAG
TCAGAAGAGCCAAGAAGCGACATGTGGAGCGACCAACAGAACTTTACAGCCTCACGGCACCTCTGGGATGCCAAA
AGCTCTGTCGAATTTTATCGGGCGTGGAGAGAAAAGCCGCACTATCTGATTGAAAACTTGTCCTTCAATGAATTC
TGGGTATACGGCCGGCCGGCCGATATTGACGAGTTTACAAGGCTGATGCTTACGGGGCAAATCGGTCCAGACGCC
ATGCATCATTTTATGCACGGAGACATAGCGGTTCCCGTGGTATGA
Gene >OphauG2|2004
ATGGCTCCTGAGCTGAATCTTGGCTTCGACGTGGACAGCAGCCTAGGATCCGAAGCCAGCCCGGACAGCCTGGAC
CAGGATACAGACGGTGTTGGGGTGCTCGATGGAGACGCAGGCGGACAAGTCGCCGAGCCCTTTTCCTTGGCCGAC
TTGATGACCGGTGACAATGGCGTCCATAATGTTTGGGATCCCCTGAGCCTCAGGGGCTATAGCGACTATGACAAT
GACAAGGTGGACTTTGACCTGCACACGATGCCATCCATGGCATGCGCCTTTGGCTCGCAGCCTCAACCCCAGCCT
CAACCCCAGTCTCAACCCCAACACCATCACCAGCCCCATCACCAGCCCCAGCGTCAGCCTCAACCAGTCCGCGAT
GTGGAAGTCTTCAAGTCCATCAAAACCATGGGGGTCGACGTCGACGCGGTCCAGGCCAATGACCCCAATTCACGC
ACCGGGTCCATAGTGGCCTTTTTCACCTCGCTAGGCTCCAAATTTAGCCAGACGCGAGCCTTGCCCTTTATACAC
GAGCGGCTCTGGTTCTCGCATTCCCCAGCAGCGCCGGCTTCTAATGATTCATGTCTGCCCCTGCCCAGCAATCCC
GGCACCAGCGGGCCTCCGCCCATGATGCTGGCTGCCTTTTCGGCAGCTGCTGCATACAGTTCGCGCACGTCCCAG
ACAACTCCCTGGGCACTGCGAATTGTCGCCGAAGCGGCCCGGGATGTGCTCAAGCAGGGCGAGCGAGCGGCAAGC
CATGCAGAACGGCTGGCGCGTGTGCAGGCGCTGACGGTGCTGAGTGTCATGTGCTTTTTTGATGGGGATATCGGC
TTGCGAGCCGCCGCGGAGCGTGGCCTTGCCACTCTGCTGGCATGGGTCAAGGACCTGGAAAGCGTCAGGAACCAA
CTCGAGGCTGAGGCGCGAGAGCGCTCTCAACTTGGCCTCTCCATGAGGGATGCGCCGCCACAGACTTGGGAGGTG
AGCAGACGCGGCTGTGTGTGCATGCACCGGCAACCATGCCATGTCGTGTGGTGCTGACTTGGCCCGGAGCAGAGC
TGGATTTTCCTCGAGAGCACGCGGCGTAGCGTCACCATGGGCTATGCATACATATGCCTCAGCCATCTGCTCAAG
TCAGAAGAGCGTACGTTTTTAGCGCCCTCTTGCCCCCTCTTTTTTCTTTTTCACTTTCGGCCCTTTGCATCCTTT
AGATGCGCTGCGACAAGCATCCTGAATGCTGACGCGAGCGCCCAACAGCAAGAAGCGACATGTGGAGCGACCAAC
AGAACTTTACAGCCTCACGGCACCTCTGGGATGCCAAAAGCTCTGTCGAATTTTATCGGGCGTGGAGAGAAAAGC
CGCACTATCTGATTGAAAACTTGTCCTTCAATGAATTCTGGGTATACGGCCGGCCGGCCGATATTGACGAGTTTA
CAAGGCTGATGCTTACGGGGTACGTGAGAGAGAGCAAGAGACAAGAGAGCAAAGATGGCATGTGCTGACTCTTGG
TCCAGGCAAATCGGTCCAGACGCCATGCATCATTTTATGCACGGAGACATAGCGGTTCCCGTGGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail