Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1996
Gene name
LocationContig_166:13561..17527
Strand-
Gene length (bp)3966
Transcript length (bp)3849
Coding sequence length (bp)3849
Protein length (aa) 1283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 4.7E-12 213 282
PF00013 KH_1 KH domain 3.8E-05 392 449
PF00013 KH_1 KH domain 3.6E-09 709 765
PF00013 KH_1 KH domain 1.8E-08 777 855
PF00013 KH_1 KH domain 5.5E-12 869 930
PF00013 KH_1 KH domain 6.2E-10 1025 1083
PF00013 KH_1 KH domain 4.1E-14 1213 1267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59810|VGL1_SCHPO Vigilin 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vgl1 PE=1 SV=2 55 1273 2.0E-115
sp|P06105|SC160_YEAST Protein SCP160 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCP160 PE=1 SV=3 142 1271 1.0E-80
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 163 1272 6.0E-59
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 163 1272 3.0E-58
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 163 1272 4.0E-58
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59810|VGL1_SCHPO Vigilin 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vgl1 PE=1 SV=2 55 1273 2.0E-115
sp|P06105|SC160_YEAST Protein SCP160 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCP160 PE=1 SV=3 142 1271 1.0E-80
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 163 1272 6.0E-59
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 163 1272 3.0E-58
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 163 1272 4.0E-58
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 163 1272 3.0E-55
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 163 1272 3.0E-53
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 695 1279 4.0E-27
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 703 1279 6.0E-27
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 703 1279 1.0E-26
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 695 1279 3.0E-26
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 197 862 1.0E-19
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 192 1095 1.0E-19
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 619 1122 2.0E-18
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 188 925 5.0E-18
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 188 925 7.0E-18
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 192 1095 1.0E-17
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 619 1122 1.0E-17
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 619 1122 2.0E-17
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 703 1279 2.0E-16
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 717 1095 9.0E-16
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 717 1095 1.0E-15
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 717 1095 4.0E-15
sp|Q00341|VIGLN_HUMAN Vigilin OS=Homo sapiens GN=HDLBP PE=1 SV=2 871 1267 5.0E-10
sp|P81021|VIGLN_CHICK Vigilin OS=Gallus gallus GN=HDLBP PE=2 SV=1 709 985 5.0E-10
sp|Q8VDJ3|VIGLN_MOUSE Vigilin OS=Mus musculus GN=Hdlbp PE=1 SV=1 871 1267 6.0E-10
sp|Q9Z1A6|VIGLN_RAT Vigilin OS=Rattus norvegicus GN=Hdlbp PE=1 SV=1 871 1267 9.0E-10
sp|Q5R439|VIGLN_PONAB Vigilin OS=Pongo abelii GN=HDLBP PE=2 SV=1 871 1267 1.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1996
MVNGNEESAAQKLLHKHAEKPRPVSVEDVPDEGFPIKPATAGPSATAPTNTVTAGPKKNVSREASRIDTSSHELF
PELGAAVKGKSANVAPVWGAKNAKINGKPNGTPPTSVSRSSTPASGTATPSRGGIPSISIPGRNSETYTLEPQFI
LPRAQLKRPITDVLKDINRKSRANITMSSAPNGRLRFDATGPQDLAQQAIKDVIEQIGSKTSIKVPIPHSARAHI
IGRGGSTIKSLQEKTGAKIQLPRVEENPVDEEDDESTIDVMVEGNALSAASAQNEILKIAGERSANMQTKVRGIP
AAFYPFIAGPSNSHVQAMEDTNNVQIRVPPYQPFSGGSGPITITPENKPVFAPAGVNQDLIQLAGDRAAVQKVRA
EIEARAAELKRLLQAEQLSIQRGRHQFIIGDLGVAAENFFAKTGCVIVLPTDGEEDMVTIVGPPDRVPNAVEHAM
DLAMGMQMSNFDIARFHRNAPCGAAVHAGYVTRYLRHCQELERLERLYHTHITTPFSEDRVQPWELYSREGKNAI
RAQSEITGIIHGHPPSRIQALPVDSFFHQHIKNDITPRVKRDFGVQIVVPEAHEPSAPILLVYQGPESAEPYNLP
RTKPSDADIKIFQQGIKDAQQHILDLIGKQEAITSTSLEVPPKFHERLRRFIKDEQEKTRASEQIPIRVNKVGTT
VTLRGPSSAVEKLAAKALAFVEQEKQDEKERGFTLTFDFPQKYANHLIGKGGSHIRELRDRFDVEIQVQDGKVEL
KGPKAKAEAARSHIQNLGRTLADETTHVLKVDPKYHRELIGSQGSQINRLQTRYKVLIFFPRSSKASDEQSSTAS
EVRSKHHQQAPDEVVIRGPKKGADEARDELFSLHRYLEEHSATATVPVQQKQVGSLIGQGGAALDELRQITGARI
DVPTDRSADMVEILVKGTASQVAHARRILEEKRAVFDDTIAQTIQVDRKHHKALVGAGGSKLREIVVGAGGSDDR
RSLARTIQLPKQDADGNGITVEGRTEVVYKIIKRIQEIVAERESQVSDMVEVPIDQHRTLIGRGGDVKRDMEARF
GVSIDVPRQGDGRTGVKVVGQAENVAKAKEHIQGLIRQQQSESLDIPRSLHHAIANNGQLFRQLRNNLQVTVDHG
GRQIPPKPEMPSKDRKTLPLITDDVSNAEDENYSWHVVQMGESGESGDIPWVMRGASENVIKAKEMVLKALEQAR
NNDSAGYLYLPDPKTYRFVIGPGGSKVNSIRQQSGCRIQVPRDQARHEAVEIIGSLEGVEKAKDLILMAIKEGTR
KWQDWEA*
Coding >OphauG2|1996
ATGGTCAATGGAAACGAAGAATCAGCTGCGCAGAAGCTGCTTCACAAGCATGCTGAAAAGCCCCGTCCCGTCAGT
GTTGAGGATGTCCCAGACGAGGGCTTCCCTATTAAGCCCGCCACCGCCGGTCCATCGGCCACTGCACCCACCAAT
ACTGTTACTGCTGGCCCGAAAAAGAACGTTTCACGAGAAGCCAGTCGTATTGACACTAGCTCCCACGAACTATTC
CCTGAACTTGGTGCTGCTGTCAAGGGAAAAAGTGCCAATGTTGCCCCTGTTTGGGGCGCCAAAAATGCAAAAATA
AATGGGAAACCCAATGGCACACCGCCAACCTCTGTGTCACGCTCATCGACGCCAGCCTCGGGCACCGCAACCCCT
TCCCGAGGTGGCATTCCCTCCATTAGCATTCCTGGCCGTAATTCGGAGACCTACACCCTTGAACCACAGTTCATC
TTGCCCCGCGCTCAGCTGAAGCGGCCCATCACAGATGTACTCAAAGACATCAATCGCAAGTCCCGTGCCAATATT
ACCATGTCTTCGGCACCAAACGGTCGACTTCGCTTTGATGCCACAGGCCCCCAGGATCTTGCCCAACAGGCCATC
AAAGACGTCATTGAACAAATTGGTAGCAAGACGTCGATCAAAGTGCCAATTCCTCACAGTGCCCGTGCACACATT
ATTGGTCGGGGTGGCTCGACCATCAAGAGCCTTCAGGAGAAAACTGGCGCAAAGATTCAACTGCCCAGAGTTGAA
GAGAACCCAGTTGACGAAGAAGATGACGAGTCTACCATTGATGTCATGGTAGAAGGGAATGCTCTTTCAGCAGCC
TCAGCTCAAAACGAAATACTCAAGATTGCTGGTGAGCGCAGCGCCAACATGCAAACCAAAGTGCGCGGCATTCCT
GCAGCATTTTACCCCTTCATAGCAGGGCCGAGTAACTCGCATGTTCAGGCCATGGAGGACACAAACAATGTGCAA
ATCCGTGTGCCTCCATATCAGCCATTTTCGGGTGGCTCTGGCCCCATTACTATCACGCCTGAAAACAAGCCTGTT
TTCGCGCCGGCTGGCGTTAACCAGGATCTCATCCAGCTTGCTGGCGACCGCGCCGCTGTGCAAAAAGTGCGTGCG
GAAATTGAAGCCCGAGCTGCCGAGCTCAAACGACTGCTCCAGGCAGAGCAACTGTCTATTCAGCGGGGCCGTCAC
CAGTTCATCATTGGCGATCTTGGCGTGGCCGCTGAAAACTTCTTTGCAAAAACTGGATGCGTCATTGTGCTTCCT
ACTGATGGTGAAGAGGATATGGTGACGATTGTTGGACCACCTGATCGGGTGCCCAATGCCGTTGAGCATGCCATG
GACCTGGCCATGGGCATGCAAATGTCCAACTTTGACATTGCTCGCTTTCATCGCAACGCTCCTTGTGGTGCGGCT
GTTCACGCCGGCTACGTCACTAGATACCTCCGCCACTGCCAAGAACTCGAGCGTCTGGAAAGACTCTATCACACG
CATATTACTACTCCATTTTCGGAGGATAGAGTCCAGCCATGGGAACTGTATTCTCGCGAAGGCAAGAACGCGATT
CGAGCACAGTCGGAGATTACAGGAATCATCCACGGCCATCCTCCATCGCGCATTCAGGCTTTGCCAGTGGATTCA
TTTTTCCATCAACACATCAAAAATGACATTACTCCACGCGTGAAGCGTGACTTTGGCGTCCAGATTGTGGTTCCC
GAGGCGCACGAGCCTAGTGCTCCAATTTTGCTCGTGTATCAAGGGCCAGAATCCGCGGAGCCATACAACCTTCCG
CGGACAAAGCCATCTGATGCGGATATCAAAATCTTTCAGCAAGGCATCAAGGATGCACAGCAACACATCTTGGAT
TTGATTGGTAAACAAGAGGCCATCACGAGCACGTCGTTGGAGGTGCCGCCAAAGTTTCACGAACGACTGCGTCGC
TTCATCAAGGATGAACAAGAAAAGACACGCGCATCTGAGCAGATTCCTATTCGCGTGAACAAGGTTGGCACCACT
GTTACGCTTCGTGGACCCTCGTCTGCAGTCGAAAAGCTTGCTGCCAAGGCTCTCGCTTTTGTAGAGCAAGAAAAG
CAAGATGAAAAGGAGCGCGGGTTTACATTGACATTTGATTTCCCCCAAAAGTACGCCAATCACCTCATTGGCAAG
GGTGGCAGCCATATCCGCGAGTTGCGTGACCGATTTGATGTCGAGATTCAGGTGCAAGATGGCAAGGTTGAACTC
AAGGGACCCAAGGCCAAGGCCGAAGCTGCGCGATCACACATTCAGAATCTTGGCCGCACGCTGGCCGATGAGACA
ACCCATGTGCTCAAGGTGGATCCGAAATACCATCGTGAGCTAATTGGCTCTCAGGGTAGCCAAATCAACCGGCTT
CAAACTCGGTACAAAGTACTCATCTTTTTCCCACGATCCTCCAAGGCTTCGGATGAGCAATCCAGTACCGCCAGT
GAAGTTCGCTCAAAGCACCATCAACAAGCGCCAGACGAAGTGGTGATTCGTGGCCCTAAAAAGGGCGCAGATGAG
GCTCGCGATGAGCTGTTTTCGCTGCATCGCTACCTTGAGGAACACTCGGCCACTGCGACTGTCCCCGTCCAGCAG
AAGCAAGTGGGATCGCTTATAGGCCAGGGTGGCGCAGCGCTTGACGAACTGCGCCAGATTACTGGAGCACGCATC
GATGTACCCACAGATCGCAGTGCGGACATGGTCGAGATACTCGTCAAAGGCACGGCGTCGCAAGTGGCTCATGCT
CGTCGAATATTGGAAGAAAAGCGTGCCGTCTTTGACGACACGATTGCGCAAACAATTCAAGTAGATCGAAAACAC
CACAAGGCCTTGGTGGGCGCTGGCGGCTCCAAGTTGCGTGAGATTGTTGTTGGAGCCGGCGGCTCTGACGACCGA
CGTAGCCTTGCGCGCACCATTCAGCTTCCTAAACAGGATGCGGATGGAAACGGCATCACGGTCGAAGGGCGGACC
GAAGTTGTGTACAAAATTATCAAGCGAATCCAGGAAATCGTTGCCGAGCGCGAGAGCCAAGTGTCGGACATGGTA
GAGGTTCCAATTGACCAGCATCGCACCTTGATAGGCCGCGGCGGGGATGTCAAACGTGACATGGAGGCACGGTTT
GGCGTGTCGATTGACGTGCCACGGCAGGGCGACGGCAGGACTGGTGTCAAGGTGGTTGGCCAGGCGGAAAACGTG
GCCAAGGCCAAGGAGCACATCCAGGGCCTCATTCGGCAGCAGCAGAGTGAAAGCCTGGATATTCCACGCAGCTTG
CACCACGCCATTGCAAACAACGGCCAGCTGTTCCGGCAGCTGCGCAACAATCTTCAAGTGACAGTTGACCATGGC
GGCCGCCAGATACCGCCCAAACCGGAAATGCCTAGCAAGGATCGAAAGACACTGCCCTTGATCACGGATGATGTG
TCAAATGCCGAAGACGAAAACTACAGCTGGCACGTGGTGCAGATGGGCGAGTCGGGCGAGTCGGGCGACATTCCA
TGGGTAATGCGTGGAGCATCTGAAAATGTCATCAAGGCAAAGGAAATGGTGCTCAAGGCACTTGAGCAGGCCCGC
AACAACGACTCGGCGGGCTATCTCTACCTGCCAGATCCCAAAACTTATCGATTCGTCATTGGTCCTGGAGGCTCA
AAGGTCAACTCTATCCGCCAGCAGAGCGGCTGCAGGATTCAAGTCCCACGAGACCAGGCTCGTCATGAGGCGGTT
GAGATTATTGGAAGTCTCGAGGGAGTTGAGAAGGCCAAGGATCTAATCCTCATGGCTATCAAGGAGGGGACTCGC
AAGTGGCAGGACTGGGAAGCCTGA
Transcript >OphauG2|1996
ATGGTCAATGGAAACGAAGAATCAGCTGCGCAGAAGCTGCTTCACAAGCATGCTGAAAAGCCCCGTCCCGTCAGT
GTTGAGGATGTCCCAGACGAGGGCTTCCCTATTAAGCCCGCCACCGCCGGTCCATCGGCCACTGCACCCACCAAT
ACTGTTACTGCTGGCCCGAAAAAGAACGTTTCACGAGAAGCCAGTCGTATTGACACTAGCTCCCACGAACTATTC
CCTGAACTTGGTGCTGCTGTCAAGGGAAAAAGTGCCAATGTTGCCCCTGTTTGGGGCGCCAAAAATGCAAAAATA
AATGGGAAACCCAATGGCACACCGCCAACCTCTGTGTCACGCTCATCGACGCCAGCCTCGGGCACCGCAACCCCT
TCCCGAGGTGGCATTCCCTCCATTAGCATTCCTGGCCGTAATTCGGAGACCTACACCCTTGAACCACAGTTCATC
TTGCCCCGCGCTCAGCTGAAGCGGCCCATCACAGATGTACTCAAAGACATCAATCGCAAGTCCCGTGCCAATATT
ACCATGTCTTCGGCACCAAACGGTCGACTTCGCTTTGATGCCACAGGCCCCCAGGATCTTGCCCAACAGGCCATC
AAAGACGTCATTGAACAAATTGGTAGCAAGACGTCGATCAAAGTGCCAATTCCTCACAGTGCCCGTGCACACATT
ATTGGTCGGGGTGGCTCGACCATCAAGAGCCTTCAGGAGAAAACTGGCGCAAAGATTCAACTGCCCAGAGTTGAA
GAGAACCCAGTTGACGAAGAAGATGACGAGTCTACCATTGATGTCATGGTAGAAGGGAATGCTCTTTCAGCAGCC
TCAGCTCAAAACGAAATACTCAAGATTGCTGGTGAGCGCAGCGCCAACATGCAAACCAAAGTGCGCGGCATTCCT
GCAGCATTTTACCCCTTCATAGCAGGGCCGAGTAACTCGCATGTTCAGGCCATGGAGGACACAAACAATGTGCAA
ATCCGTGTGCCTCCATATCAGCCATTTTCGGGTGGCTCTGGCCCCATTACTATCACGCCTGAAAACAAGCCTGTT
TTCGCGCCGGCTGGCGTTAACCAGGATCTCATCCAGCTTGCTGGCGACCGCGCCGCTGTGCAAAAAGTGCGTGCG
GAAATTGAAGCCCGAGCTGCCGAGCTCAAACGACTGCTCCAGGCAGAGCAACTGTCTATTCAGCGGGGCCGTCAC
CAGTTCATCATTGGCGATCTTGGCGTGGCCGCTGAAAACTTCTTTGCAAAAACTGGATGCGTCATTGTGCTTCCT
ACTGATGGTGAAGAGGATATGGTGACGATTGTTGGACCACCTGATCGGGTGCCCAATGCCGTTGAGCATGCCATG
GACCTGGCCATGGGCATGCAAATGTCCAACTTTGACATTGCTCGCTTTCATCGCAACGCTCCTTGTGGTGCGGCT
GTTCACGCCGGCTACGTCACTAGATACCTCCGCCACTGCCAAGAACTCGAGCGTCTGGAAAGACTCTATCACACG
CATATTACTACTCCATTTTCGGAGGATAGAGTCCAGCCATGGGAACTGTATTCTCGCGAAGGCAAGAACGCGATT
CGAGCACAGTCGGAGATTACAGGAATCATCCACGGCCATCCTCCATCGCGCATTCAGGCTTTGCCAGTGGATTCA
TTTTTCCATCAACACATCAAAAATGACATTACTCCACGCGTGAAGCGTGACTTTGGCGTCCAGATTGTGGTTCCC
GAGGCGCACGAGCCTAGTGCTCCAATTTTGCTCGTGTATCAAGGGCCAGAATCCGCGGAGCCATACAACCTTCCG
CGGACAAAGCCATCTGATGCGGATATCAAAATCTTTCAGCAAGGCATCAAGGATGCACAGCAACACATCTTGGAT
TTGATTGGTAAACAAGAGGCCATCACGAGCACGTCGTTGGAGGTGCCGCCAAAGTTTCACGAACGACTGCGTCGC
TTCATCAAGGATGAACAAGAAAAGACACGCGCATCTGAGCAGATTCCTATTCGCGTGAACAAGGTTGGCACCACT
GTTACGCTTCGTGGACCCTCGTCTGCAGTCGAAAAGCTTGCTGCCAAGGCTCTCGCTTTTGTAGAGCAAGAAAAG
CAAGATGAAAAGGAGCGCGGGTTTACATTGACATTTGATTTCCCCCAAAAGTACGCCAATCACCTCATTGGCAAG
GGTGGCAGCCATATCCGCGAGTTGCGTGACCGATTTGATGTCGAGATTCAGGTGCAAGATGGCAAGGTTGAACTC
AAGGGACCCAAGGCCAAGGCCGAAGCTGCGCGATCACACATTCAGAATCTTGGCCGCACGCTGGCCGATGAGACA
ACCCATGTGCTCAAGGTGGATCCGAAATACCATCGTGAGCTAATTGGCTCTCAGGGTAGCCAAATCAACCGGCTT
CAAACTCGGTACAAAGTACTCATCTTTTTCCCACGATCCTCCAAGGCTTCGGATGAGCAATCCAGTACCGCCAGT
GAAGTTCGCTCAAAGCACCATCAACAAGCGCCAGACGAAGTGGTGATTCGTGGCCCTAAAAAGGGCGCAGATGAG
GCTCGCGATGAGCTGTTTTCGCTGCATCGCTACCTTGAGGAACACTCGGCCACTGCGACTGTCCCCGTCCAGCAG
AAGCAAGTGGGATCGCTTATAGGCCAGGGTGGCGCAGCGCTTGACGAACTGCGCCAGATTACTGGAGCACGCATC
GATGTACCCACAGATCGCAGTGCGGACATGGTCGAGATACTCGTCAAAGGCACGGCGTCGCAAGTGGCTCATGCT
CGTCGAATATTGGAAGAAAAGCGTGCCGTCTTTGACGACACGATTGCGCAAACAATTCAAGTAGATCGAAAACAC
CACAAGGCCTTGGTGGGCGCTGGCGGCTCCAAGTTGCGTGAGATTGTTGTTGGAGCCGGCGGCTCTGACGACCGA
CGTAGCCTTGCGCGCACCATTCAGCTTCCTAAACAGGATGCGGATGGAAACGGCATCACGGTCGAAGGGCGGACC
GAAGTTGTGTACAAAATTATCAAGCGAATCCAGGAAATCGTTGCCGAGCGCGAGAGCCAAGTGTCGGACATGGTA
GAGGTTCCAATTGACCAGCATCGCACCTTGATAGGCCGCGGCGGGGATGTCAAACGTGACATGGAGGCACGGTTT
GGCGTGTCGATTGACGTGCCACGGCAGGGCGACGGCAGGACTGGTGTCAAGGTGGTTGGCCAGGCGGAAAACGTG
GCCAAGGCCAAGGAGCACATCCAGGGCCTCATTCGGCAGCAGCAGAGTGAAAGCCTGGATATTCCACGCAGCTTG
CACCACGCCATTGCAAACAACGGCCAGCTGTTCCGGCAGCTGCGCAACAATCTTCAAGTGACAGTTGACCATGGC
GGCCGCCAGATACCGCCCAAACCGGAAATGCCTAGCAAGGATCGAAAGACACTGCCCTTGATCACGGATGATGTG
TCAAATGCCGAAGACGAAAACTACAGCTGGCACGTGGTGCAGATGGGCGAGTCGGGCGAGTCGGGCGACATTCCA
TGGGTAATGCGTGGAGCATCTGAAAATGTCATCAAGGCAAAGGAAATGGTGCTCAAGGCACTTGAGCAGGCCCGC
AACAACGACTCGGCGGGCTATCTCTACCTGCCAGATCCCAAAACTTATCGATTCGTCATTGGTCCTGGAGGCTCA
AAGGTCAACTCTATCCGCCAGCAGAGCGGCTGCAGGATTCAAGTCCCACGAGACCAGGCTCGTCATGAGGCGGTT
GAGATTATTGGAAGTCTCGAGGGAGTTGAGAAGGCCAAGGATCTAATCCTCATGGCTATCAAGGAGGGGACTCGC
AAGTGGCAGGACTGGGAAGCCTGA
Gene >OphauG2|1996
ATGGTCAATGGAAACGAAGAATCAGCTGCGCAGAAGCTGCTTCACAAGCATGCTGAAAAGCCCCGTCCCGTCAGT
GTTGAGGATGTCCCAGACGAGGGCTTCCCTATTAAGCCCGCCACCGCCGGTCCATCGGCCACTGCACCCACCAAT
ACTGTTACTGCTGGCCCGAAAAAGAACGTTTCACGAGAAGCCAGTCGTATTGACACTAGCTCCCACGAACTATTC
CCTGAACTTGGTGCTGCTGTCAAGGGAAAAAGTGCCAATGTTGCCCCTGTTTGGGGCGCCAAAAATGCAAAAATA
AATGGGAAACCCAATGGCACACCGCCAACCTCTGTGTCACGCTCATCGACGCCAGCCTCGGGCACCGCAACCCCT
TCCCGAGGTGGCATTCCCTCCATTAGCATTCCTGGCCGTAATTCGGAGACCTACACCCTTGAACCACAGTTCATC
TTGCCCCGCGCTCAGCTGAAGCGGCCCATCACAGATGTACTCAAAGACATCAATCGCAAGTCCCGTGCCAATATT
ACCATGTCTTCGGCACCAAACGGTCGACTTCGCTTTGATGCCACAGGCCCCCAGGATCTTGCCCAACAGGCCATC
AAAGACGTCATTGAACAAATTGGTAGCAAGGTACGTGTAGTCTATACCACGAATAAAGTGCTCTATATCATCTAA
CACGTTGAAGACGTCGATCAAAGTGCCAATTCCTCACAGTGCCCGTGCACACATTATTGGTCGGGGTGGCTCGAC
CATCAAGAGCCTTCAGGAGAAAACTGGCGCAAAGATTCAACTGCCCAGAGTTGAAGAGAACCCAGTTGACGAAGA
AGATGACGAGTCTACCATTGATGTCATGGTAGAAGGGAATGCTCTTTCAGCAGCCTCAGCTCAAAACGAAATACT
CAAGATTGCTGGTGAGCGCAGCGCCAACATGCAAACCAAAGTGCGCGGCATTCCTGCAGCATTTTACCCCTTCAT
AGCAGGGCCGAGTAACTCGCATGTTCAGGCCATGGAGGACACAAACAATGTGCAAATCCGTGTGCCTCCATATCA
GCCATTTTCGGGTGGCTCTGGCCCCATTACTATCACGCCTGAAAACAAGCCTGTTTTCGCGCCGGCTGGCGTTAA
CCAGGATCTCATCCAGCTTGCTGGCGACCGCGCCGCTGTGCAAAAAGTGCGTGCGGAAATTGAAGCCCGAGCTGC
CGAGCTCAAACGACTGCTCCAGGCAGAGCAACTGTCTATTCAGCGGGGCCGTCACCAGTTCATCATTGGCGATCT
TGGCGTGGCCGCTGAAAACTTCTTTGCAAAAACTGGATGCGTCATTGTGCTTCCTACTGATGGTGAAGAGGATAT
GGTGACGATTGTTGGACCACCTGATCGGGTGCCCAATGCCGTTGAGCATGCCATGGACCTGGCCATGGGCATGCA
AATGTCCAACTTTGACATTGCTCGCTTTCATCGCAACGCTCCTTGTGGTGCGGCTGTTCACGCCGGCTACGTCAC
TAGATACCTCCGCCACTGCCAAGAACTCGAGCGTCTGGAAAGACTCTATCACACGCATATTACTACTCCATTTTC
GGAGGATAGAGTCCAGCCATGGGAACTGTATTCTCGCGAAGGCAAGAACGCGATTCGAGCACAGTCGGAGATTAC
AGGAATCATCCACGGCCATCCTCCATCGCGCATTCAGGCTTTGCCAGTGGATTCATTTTTCCATCAACACATCAA
AAATGACATTACTCCACGCGTGAAGCGTGACTTTGGCGTCCAGATTGTGGTTCCCGAGGCGCACGAGCCTAGTGC
TCCAATTTTGCTCGTGTATCAAGGGCCAGAATCCGCGGAGCCATACAACCTTCCGCGGACAAAGCCATCTGATGC
GGATATCAAAATCTTTCAGCAAGGCATCAAGGATGCACAGCAACACATCTTGGATTTGATTGGTAAACAAGAGGC
CATCACGAGCACGTCGTTGGAGGTGCCGCCAAAGTTTCACGAACGACTGCGTCGCTTCATCAAGGATGAACAAGA
AAAGACACGCGCATCTGAGCAGATTCCTATTCGCGTGAACAAGGTTGGCACCACTGTTACGCTTCGTGGACCCTC
GTCTGCAGTCGAAAAGCTTGCTGCCAAGGCTCTCGCTTTTGTAGAGCAAGAAAAGCAAGATGAAAAGGAGCGCGG
GTTTACATTGACATTTGATTTCCCCCAAAAGTACGCCAATCACCTCATTGGCAAGGGTGGCAGCCATATCCGCGA
GTTGCGTGACCGATTTGATGTCGAGATTCAGGTGCAAGATGGCAAGGTTGAACTCAAGGGACCCAAGGCCAAGGC
CGAAGCTGCGCGATCACACATTCAGAATCTTGGCCGCACGCTGGCCGATGAGACAACCCATGTGCTCAAGGTGGA
TCCGAAATACCATCGTGAGCTAATTGGCTCTCAGGGTAGCCAAATCAACCGGCTTCAAACTCGGTACAAAGTACT
CATCTTTTTCCCACGATCCTCCAAGGCTTCGGATGAGCAATCCAGTACCGCCAGTGAAGTTCGCTCAAAGCACCA
TCAACAAGCGCCAGACGAAGTGGTGATTCGTGGCCCTAAAAAGGGCGCAGATGAGGCTCGCGATGAGCTGTTTTC
GCTGCATCGCTACCTTGAGGAACACTCGGCCACTGCGACTGTCCCCGTCCAGCAGAAGCAAGTGGGATCGCTTAT
AGGCCAGGGTGGCGCAGCGCTTGACGAACTGCGCCAGATTACTGGAGCACGCATCGATGTACCCACAGATCGCAG
TGCGGACATGGTCGAGATACTCGTCAAAGGCACGGCGTCGCAAGTGGCTCATGCTCGTCGAATATTGGAAGAAAA
GCGTGCCGTCTTTGACGACACGATTGCGCAAACAATTCAAGTAGATCGAAAACACCACAAGGCCTTGGTGGGCGC
TGGCGGTAAGTGGTGACGACGACCCCATTTTTTACCAGAGATGGATGGGCTAATATAATAGGCGCAGGCTCCAAG
TTGCGTGAGATTGTTGTTGGAGCCGGCGGCTCTGACGACCGACGTAGCCTTGCGCGCACCATTCAGCTTCCTAAA
CAGGATGCGGATGGAAACGGCATCACGGTCGAAGGGCGGACCGAAGTTGTGTACAAAATTATCAAGCGAATCCAG
GAAATCGTTGCCGAGCGCGAGAGCCAAGTGTCGGACATGGTAGAGGTTCCAATTGACCAGCATCGCACCTTGATA
GGCCGCGGCGGGGATGTCAAACGTGACATGGAGGCACGGTTTGGCGTGTCGATTGACGTGCCACGGCAGGGCGAC
GGCAGGACTGGTGTCAAGGTGGTTGGCCAGGCGGAAAACGTGGCCAAGGCCAAGGAGCACATCCAGGGCCTCATT
CGGCAGCAGCAGAGTGAAAGCCTGGATATTCCACGCAGCTTGCACCACGCCATTGCAAACAACGGCCAGCTGTTC
CGGCAGCTGCGCAACAATCTTCAAGTGACAGTTGACCATGGCGGCCGCCAGATACCGCCCAAACCGGAAATGCCT
AGCAAGGATCGAAAGACACTGCCCTTGATCACGGATGATGTGTCAAATGCCGAAGACGAAAACTACAGCTGGCAC
GTGGTGCAGATGGGCGAGTCGGGCGAGTCGGGCGACATTCCATGGGTAATGCGTGGAGCATCTGAAAATGTCATC
AAGGCAAAGGAAATGGTGCTCAAGGCACTTGAGCAGGCCCGCAACAACGACTCGGCGGGCTATCTCTACCTGCCA
GATCCCAAAACTTATCGATTCGTCATTGGTCCTGGAGGCTCAAAGGTCAACTCTATCCGCCAGCAGAGCGGCTGC
AGGATTCAAGTCCCACGAGACCAGGCTCGTCATGAGGCGGTTGAGATTATTGGAAGTCTCGAGGGAGTTGAGAAG
GCCAAGGATCTAATCCTCATGGCTATCAAGGAGGGGACTCGCAAGTGGCAGGACTGGGAAGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail