Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1992
Gene name
LocationContig_166:2165..3749
Strand-
Gene length (bp)1584
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01926 MMR_HSR1 50S ribosome-binding GTPase 1.8E-11 153 320
PF00350 Dynamin_N Dynamin family 5.0E-07 154 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q042T8|ENGB_LACGA Probable GTP-binding protein EngB OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=engB PE=3 SV=1 148 323 5.0E-14
sp|Q21TK4|ENGB_RHOFT Probable GTP-binding protein EngB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=engB PE=3 SV=1 126 301 2.0E-12
sp|Q67SJ6|ENGB_SYMTH Probable GTP-binding protein EngB OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=engB PE=3 SV=1 147 356 2.0E-12
sp|B8F8H7|ENGB_HAEPS Probable GTP-binding protein EngB OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=engB PE=3 SV=1 129 323 1.0E-11
sp|B7GH28|ENGB_ANOFW Probable GTP-binding protein EngB OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=engB PE=3 SV=1 149 323 1.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q042T8|ENGB_LACGA Probable GTP-binding protein EngB OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=engB PE=3 SV=1 148 323 5.0E-14
sp|Q21TK4|ENGB_RHOFT Probable GTP-binding protein EngB OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=engB PE=3 SV=1 126 301 2.0E-12
sp|Q67SJ6|ENGB_SYMTH Probable GTP-binding protein EngB OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=engB PE=3 SV=1 147 356 2.0E-12
sp|B8F8H7|ENGB_HAEPS Probable GTP-binding protein EngB OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=engB PE=3 SV=1 129 323 1.0E-11
sp|B7GH28|ENGB_ANOFW Probable GTP-binding protein EngB OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=engB PE=3 SV=1 149 323 1.0E-11
sp|C5D5L1|ENGB_GEOSW Probable GTP-binding protein EngB OS=Geobacillus sp. (strain WCH70) GN=engB PE=3 SV=1 150 373 2.0E-11
sp|A1JHT4|ENGB_YERE8 Probable GTP-binding protein EngB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=engB PE=3 SV=1 129 323 6.0E-11
sp|Q7VNY0|ENGB_HAEDU Probable GTP-binding protein EngB OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=engB PE=3 SV=1 129 323 7.0E-11
sp|C4L968|ENGB_TOLAT Probable GTP-binding protein EngB OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=engB PE=3 SV=1 129 323 2.0E-10
sp|Q9K8F7|ENGB_BACHD Probable GTP-binding protein EngB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=engB PE=3 SV=1 147 342 3.0E-10
sp|Q12FG5|ENGB_POLSJ Probable GTP-binding protein EngB OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=engB PE=3 SV=1 122 300 4.0E-10
sp|Q65GJ7|ENGB_BACLD Probable GTP-binding protein EngB OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=engB PE=3 SV=1 150 375 6.0E-10
sp|B5EEM1|ENGB_GEOBB Probable GTP-binding protein EngB OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=engB PE=3 SV=1 128 378 7.0E-10
sp|A8FFV6|ENGB_BACP2 Probable GTP-binding protein EngB OS=Bacillus pumilus (strain SAFR-032) GN=engB PE=3 SV=1 150 339 1.0E-09
sp|Q1LTY0|ENGB_BAUCH Probable GTP-binding protein EngB OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=engB PE=3 SV=1 129 323 2.0E-09
sp|A7Z7A9|ENGB_BACMF Probable GTP-binding protein EngB OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=engB PE=3 SV=1 150 344 2.0E-09
sp|A5G964|ENGB_GEOUR Probable GTP-binding protein EngB OS=Geobacter uraniireducens (strain Rf4) GN=engB PE=3 SV=1 149 354 3.0E-09
sp|B9MDD6|ENGB_ACIET Probable GTP-binding protein EngB OS=Acidovorax ebreus (strain TPSY) GN=engB PE=3 SV=1 126 213 3.0E-09
sp|P38424|ENGB_BACSU Probable GTP-binding protein EngB OS=Bacillus subtilis (strain 168) GN=engB PE=1 SV=1 150 339 4.0E-09
sp|Q8EPM2|ENGB_OCEIH Probable GTP-binding protein EngB OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=engB PE=3 SV=1 148 323 1.0E-08
sp|Q21PP0|ENGB_SACD2 Probable GTP-binding protein EngB OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=engB PE=3 SV=1 129 323 1.0E-08
sp|B5FFA6|ENGB_VIBFM Probable GTP-binding protein EngB OS=Vibrio fischeri (strain MJ11) GN=engB PE=3 SV=1 129 323 2.0E-08
sp|C5BJZ8|ENGB_TERTT Probable GTP-binding protein EngB OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=engB PE=3 SV=1 129 323 2.0E-08
sp|Q5E8S6|ENGB_VIBF1 Probable GTP-binding protein EngB OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=engB PE=3 SV=1 129 323 2.0E-08
sp|Q2GAU7|ENGB_NOVAD Probable GTP-binding protein EngB OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=engB PE=3 SV=1 126 207 2.0E-08
sp|Q8DUH9|ENGB_STRMU Probable GTP-binding protein EngB OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=engB PE=3 SV=1 148 194 3.0E-08
sp|Q8DZ11|ENGB_STRA5 Probable GTP-binding protein EngB OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=engB PE=3 SV=1 148 194 3.0E-08
sp|Q3K0K1|ENGB_STRA1 Probable GTP-binding protein EngB OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=engB PE=3 SV=1 148 194 3.0E-08
sp|Q8E4L9|ENGB_STRA3 Probable GTP-binding protein EngB OS=Streptococcus agalactiae serotype III (strain NEM316) GN=engB PE=3 SV=1 148 194 3.0E-08
sp|Q03LM9|ENGB_STRTD Probable GTP-binding protein EngB OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=engB PE=3 SV=1 148 194 3.0E-08
sp|Q5M5A9|ENGB_STRT2 Probable GTP-binding protein EngB OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=engB PE=3 SV=1 148 194 4.0E-08
sp|Q5M0S3|ENGB_STRT1 Probable GTP-binding protein EngB OS=Streptococcus thermophilus (strain CNRZ 1066) GN=engB PE=3 SV=1 148 194 4.0E-08
sp|Q6F1A9|ENGB_MESFL Probable GTP-binding protein EngB OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=engB PE=3 SV=1 129 323 4.0E-08
sp|B9DU74|ENGB_STRU0 Probable GTP-binding protein EngB OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=engB PE=3 SV=1 148 194 5.0E-08
sp|Q026Q1|ENGB_SOLUE Probable GTP-binding protein EngB OS=Solibacter usitatus (strain Ellin6076) GN=engB PE=3 SV=1 147 194 1.0E-07
sp|B5XL04|ENGB_STRPZ Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=engB PE=3 SV=1 148 194 1.0E-07
sp|Q1JHC1|ENGB_STRPD Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=engB PE=3 SV=1 148 194 1.0E-07
sp|Q1JM76|ENGB_STRPC Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=engB PE=3 SV=1 148 194 1.0E-07
sp|Q1JC92|ENGB_STRPB Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=engB PE=3 SV=1 148 194 1.0E-07
sp|Q8P1C8|ENGB_STRP8 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|Q5XCL9|ENGB_STRP6 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|Q48U21|ENGB_STRPM Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|C0MA50|ENGB_STRE4 Probable GTP-binding protein EngB OS=Streptococcus equi subsp. equi (strain 4047) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|P0DA93|ENGB_STRPQ Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|A2RF16|ENGB_STRPG Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|P0DA92|ENGB_STRP3 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|Q9A088|ENGB_STRP1 Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M1 GN=engB PE=3 SV=1 148 194 2.0E-07
sp|Q1J740|ENGB_STRPF Probable GTP-binding protein EngB OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=engB PE=3 SV=1 148 194 2.0E-07
sp|C0MEW6|ENGB_STRS7 Probable GTP-binding protein EngB OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=engB PE=3 SV=1 148 194 3.0E-07
sp|A3CMV2|ENGB_STRSV Probable GTP-binding protein EngB OS=Streptococcus sanguinis (strain SK36) GN=engB PE=3 SV=1 148 194 3.0E-07
sp|B4S284|ENGB_ALTMD Probable GTP-binding protein EngB OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=engB PE=3 SV=1 126 194 3.0E-07
sp|B2IR86|ENGB_STRPS Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain CGSP14) GN=engB PE=3 SV=1 148 194 3.0E-07
sp|C1CSI8|ENGB_STRZT Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=engB PE=3 SV=1 148 194 4.0E-07
sp|B8ZLT0|ENGB_STRPJ Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=engB PE=3 SV=1 148 194 4.0E-07
sp|B1ICY8|ENGB_STRPI Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=engB PE=3 SV=1 148 194 4.0E-07
sp|Q2GGM7|ENGB_EHRCR Probable GTP-binding protein EngB OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=engB PE=3 SV=1 123 330 4.0E-07
sp|Q2NQR6|ENGB_SODGM Probable GTP-binding protein EngB OS=Sodalis glossinidius (strain morsitans) GN=engB PE=3 SV=1 129 323 4.0E-07
sp|C1CFF1|ENGB_STRZJ Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain JJA) GN=engB PE=3 SV=1 148 194 5.0E-07
sp|Q04JI0|ENGB_STRP2 Probable GTP-binding protein EngB OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=engB PE=3 SV=1 148 194 5.0E-07
sp|B5E6L1|ENGB_STRP4 Probable GTP-binding protein EngB OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=engB PE=3 SV=1 148 194 5.0E-07
sp|P64072|ENGB_STRPN Probable GTP-binding protein EngB OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=engB PE=3 SV=1 148 194 5.0E-07
sp|P64073|ENGB_STRR6 Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=engB PE=3 SV=1 148 194 5.0E-07
sp|C1C8F9|ENGB_STRP7 Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain 70585) GN=engB PE=3 SV=1 148 194 5.0E-07
sp|C1CLR7|ENGB_STRZP Probable GTP-binding protein EngB OS=Streptococcus pneumoniae (strain P1031) GN=engB PE=3 SV=1 148 194 6.0E-07
sp|A8AXB8|ENGB_STRGC Probable GTP-binding protein EngB OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=engB PE=3 SV=1 148 194 6.0E-07
sp|Q6F7Q4|ENGB_ACIAD Probable GTP-binding protein EngB OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=engB PE=3 SV=2 137 345 7.0E-07
sp|Q2SSN1|ENGB_MYCCT Probable GTP-binding protein EngB OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=engB PE=3 SV=1 130 195 8.0E-07
sp|A3M990|ENGB_ACIBT Probable GTP-binding protein EngB OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=engB PE=3 SV=1 144 345 9.0E-07
sp|O81004|Y2287_ARATH GTP-binding protein At2g22870 OS=Arabidopsis thaliana GN=EMB2001 PE=2 SV=2 129 195 1.0E-06
sp|Q833M8|ENGB_ENTFA Probable GTP-binding protein EngB OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=engB PE=3 SV=1 149 194 2.0E-06
sp|Q8Y6X3|ENGB_LISMO Probable GTP-binding protein EngB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=engB PE=3 SV=1 149 194 3.0E-06
sp|A0AJ07|ENGB_LISW6 Probable GTP-binding protein EngB OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=engB PE=3 SV=1 149 194 3.0E-06
sp|C1KVK5|ENGB_LISMC Probable GTP-binding protein EngB OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=engB PE=3 SV=1 149 194 3.0E-06
sp|Q71ZB0|ENGB_LISMF Probable GTP-binding protein EngB OS=Listeria monocytogenes serotype 4b (strain F2365) GN=engB PE=3 SV=1 149 194 3.0E-06
sp|B8DHJ0|ENGB_LISMH Probable GTP-binding protein EngB OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=engB PE=3 SV=1 149 194 3.0E-06
sp|Q92BF6|ENGB_LISIN Probable GTP-binding protein EngB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=engB PE=3 SV=1 149 194 3.0E-06
sp|Q6MTV5|ENGB_MYCMS Probable GTP-binding protein EngB OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=engB PE=3 SV=1 146 195 4.0E-06
sp|Q1QE34|ENGB_PSYCK Probable GTP-binding protein EngB OS=Psychrobacter cryohalolentis (strain K5) GN=engB PE=3 SV=2 137 213 5.0E-06
sp|Q4FV29|ENGB_PSYA2 Probable GTP-binding protein EngB OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=engB PE=3 SV=2 137 213 6.0E-06
sp|A0M537|ENGB_GRAFK Probable GTP-binding protein EngB OS=Gramella forsetii (strain KT0803) GN=engB PE=3 SV=1 147 195 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3455
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1992 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7264
Ophiocordyceps camponoti-floridani Ophcf2|01353
Ophiocordyceps camponoti-rufipedis Ophun1|7403
Ophiocordyceps kimflemingae Ophio5|7598
Ophiocordyceps subramaniannii Hirsu2|6589

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1992
MRKPRPDLHQTMHKAKYLEYNFAQIMQQPQIEDDLINITFRERLKRKEFGATIRGAAFAEAARPLLVSETDDSPE
THRQLYRSVADVGSRQLDLATVQGVSFSRNDYLAVHLDSSEQDYDTSRTLLSFFKKTQFLYSAPYFRNLRVNDEV
PEFVVLGASNCGKSSFINALLGNRQVAYSSKKPGATECLNSYAIGVVTKDIAPPLPGEPTAGVVSIHPKRKRRRR
RKKKKKPEIVRNDLMMASASPSCRGLVLVDTPGYGFRSRFAFGDAVMQYLGRRRLLRGAILLLSITKSNPVSEQD
EWILRALALNATPTLVVVTKIDKKGIEWPDRCAVFGQRLLNDLDQINKQSALGKWRTSTDQDNHSIWFTASRLKA
LVSKNCGIAHIRKLLVEMAGLHVHNDSVCNKQETIEYNGPVVSHQELQEAATAAAAPPIPQTSPGRQPKDRSRRK
PLPRQDYLRIMQKAGPWPTIGPDDPAPITPTATGYAPPPEPAGPEPSPEMALKKEQEDVKAARRVYAWAKKPRRL
RR*
Coding >OphauG2|1992
ATGCGCAAGCCGCGTCCAGACCTGCACCAAACGATGCACAAGGCCAAATATCTCGAGTACAACTTTGCGCAGATT
ATGCAACAGCCACAGATTGAGGATGACTTGATCAACATTACCTTCCGGGAGAGGCTGAAGCGGAAAGAGTTTGGC
GCAACGATTCGCGGCGCCGCGTTTGCTGAGGCGGCTCGCCCGCTCTTGGTGTCGGAGACTGACGACTCCCCGGAA
ACGCACCGCCAGCTATACCGCTCGGTTGCAGACGTGGGCAGTCGCCAGCTCGACCTGGCCACCGTGCAGGGCGTC
TCGTTTAGTCGGAATGACTACCTCGCCGTACACCTGGACAGCTCCGAGCAAGACTACGACACGTCGCGCACCCTC
TTGTCCTTTTTTAAAAAGACGCAGTTTCTCTACTCGGCGCCGTATTTTCGCAATCTGCGCGTCAATGACGAGGTT
CCCGAATTTGTTGTCCTCGGCGCCTCAAACTGCGGCAAGTCGAGCTTCATCAATGCCCTCCTCGGCAACAGGCAA
GTCGCCTACTCGAGTAAGAAACCGGGCGCTACCGAATGCCTAAACTCGTATGCCATTGGCGTTGTCACCAAGGAC
ATTGCCCCTCCGCTTCCAGGCGAGCCCACCGCCGGCGTCGTTTCCATACACCCCAAGCGCAAGAGGCGCAGGAGG
CGCAAGAAGAAGAAGAAGCCCGAAATCGTCAGAAACGACCTCATGATGGCCAGCGCGTCGCCCTCGTGCCGCGGC
CTCGTCCTCGTCGACACGCCCGGCTACGGCTTTCGCAGCCGCTTCGCCTTTGGCGATGCCGTTATGCAGTACCTC
GGCCGCCGCCGTCTGCTCCGCGGCGCCATCCTGCTCCTCTCCATCACCAAGAGCAACCCCGTCAGCGAACAGGAC
GAGTGGATCCTGCGCGCCCTCGCCCTCAACGCCACGCCCACCCTCGTCGTCGTTACGAAAATTGACAAAAAGGGC
ATCGAGTGGCCCGACAGGTGCGCCGTCTTTGGCCAGCGTCTCCTCAACGACCTGGACCAAATCAACAAGCAGTCC
GCCCTTGGCAAATGGCGCACGTCGACGGACCAAGACAACCACTCCATTTGGTTCACTGCCTCGCGCCTCAAGGCC
CTTGTCTCCAAGAACTGCGGCATCGCCCACATTCGCAAACTCCTTGTTGAAATGGCCGGCCTCCACGTCCACAAC
GACTCCGTCTGCAACAAGCAAGAAACTATTGAATACAATGGCCCCGTCGTCTCCCACCAAGAGCTGCAAGAAGCC
GCCACCGCCGCCGCCGCACCCCCCATCCCCCAAACTAGTCCAGGCAGACAGCCAAAGGACCGCTCCCGACGCAAG
CCCCTCCCCCGCCAAGACTACCTGCGCATCATGCAAAAGGCCGGGCCCTGGCCCACGATAGGCCCAGATGACCCT
GCTCCAATCACCCCAACCGCCACGGGCTATGCGCCCCCGCCCGAACCCGCCGGGCCTGAACCTAGCCCTGAAATG
GCCTTGAAAAAGGAACAAGAGGACGTAAAGGCTGCGAGACGTGTTTATGCATGGGCCAAGAAGCCCCGTAGGTTG
CGTAGATAG
Transcript >OphauG2|1992
ATGCGCAAGCCGCGTCCAGACCTGCACCAAACGATGCACAAGGCCAAATATCTCGAGTACAACTTTGCGCAGATT
ATGCAACAGCCACAGATTGAGGATGACTTGATCAACATTACCTTCCGGGAGAGGCTGAAGCGGAAAGAGTTTGGC
GCAACGATTCGCGGCGCCGCGTTTGCTGAGGCGGCTCGCCCGCTCTTGGTGTCGGAGACTGACGACTCCCCGGAA
ACGCACCGCCAGCTATACCGCTCGGTTGCAGACGTGGGCAGTCGCCAGCTCGACCTGGCCACCGTGCAGGGCGTC
TCGTTTAGTCGGAATGACTACCTCGCCGTACACCTGGACAGCTCCGAGCAAGACTACGACACGTCGCGCACCCTC
TTGTCCTTTTTTAAAAAGACGCAGTTTCTCTACTCGGCGCCGTATTTTCGCAATCTGCGCGTCAATGACGAGGTT
CCCGAATTTGTTGTCCTCGGCGCCTCAAACTGCGGCAAGTCGAGCTTCATCAATGCCCTCCTCGGCAACAGGCAA
GTCGCCTACTCGAGTAAGAAACCGGGCGCTACCGAATGCCTAAACTCGTATGCCATTGGCGTTGTCACCAAGGAC
ATTGCCCCTCCGCTTCCAGGCGAGCCCACCGCCGGCGTCGTTTCCATACACCCCAAGCGCAAGAGGCGCAGGAGG
CGCAAGAAGAAGAAGAAGCCCGAAATCGTCAGAAACGACCTCATGATGGCCAGCGCGTCGCCCTCGTGCCGCGGC
CTCGTCCTCGTCGACACGCCCGGCTACGGCTTTCGCAGCCGCTTCGCCTTTGGCGATGCCGTTATGCAGTACCTC
GGCCGCCGCCGTCTGCTCCGCGGCGCCATCCTGCTCCTCTCCATCACCAAGAGCAACCCCGTCAGCGAACAGGAC
GAGTGGATCCTGCGCGCCCTCGCCCTCAACGCCACGCCCACCCTCGTCGTCGTTACGAAAATTGACAAAAAGGGC
ATCGAGTGGCCCGACAGGTGCGCCGTCTTTGGCCAGCGTCTCCTCAACGACCTGGACCAAATCAACAAGCAGTCC
GCCCTTGGCAAATGGCGCACGTCGACGGACCAAGACAACCACTCCATTTGGTTCACTGCCTCGCGCCTCAAGGCC
CTTGTCTCCAAGAACTGCGGCATCGCCCACATTCGCAAACTCCTTGTTGAAATGGCCGGCCTCCACGTCCACAAC
GACTCCGTCTGCAACAAGCAAGAAACTATTGAATACAATGGCCCCGTCGTCTCCCACCAAGAGCTGCAAGAAGCC
GCCACCGCCGCCGCCGCACCCCCCATCCCCCAAACTAGTCCAGGCAGACAGCCAAAGGACCGCTCCCGACGCAAG
CCCCTCCCCCGCCAAGACTACCTGCGCATCATGCAAAAGGCCGGGCCCTGGCCCACGATAGGCCCAGATGACCCT
GCTCCAATCACCCCAACCGCCACGGGCTATGCGCCCCCGCCCGAACCCGCCGGGCCTGAACCTAGCCCTGAAATG
GCCTTGAAAAAGGAACAAGAGGACGTAAAGGCTGCGAGACGTGTTTATGCATGGGCCAAGAAGCCCCGTAGGTTG
CGTAGATAG
Gene >OphauG2|1992
ATGCGCAAGCCGCGTCCAGACCTGCACCAAACGATGCACAAGGCCAAATATCTCGAGTACAACTTTGCGCAGATT
ATGCAACAGCCACAGATTGAGGATGACTTGATCAACATTACCTTCCGGGAGAGGCTGAAGCGGAAAGAGTTTGGC
GCAACGATTCGCGGCGCCGCGTTTGCTGAGGCGGCTCGCCCGCTCTTGGTGTCGGAGACTGACGACTCCCCGGAA
ACGCACCGCCAGCTATACCGCTCGGTTGCAGACGTGGGCAGTCGCCAGCTCGACCTGGCCACCGTGCAGGGCGTC
TCGTTTAGTCGGAATGACTACCTCGCCGTACACCTGGACAGCTCCGAGCAAGACTACGACACGTCGCGCACCCTC
TTGTCCTTTTTTAAAAAGACGCAGTTTCTCTACTCGGCGCCGTATTTTCGCAATCTGCGCGTCAATGACGAGGTT
CCCGAATTTGTTGTCCTCGGCGCCTCAAACTGCGGCAAGTCGAGCTTCATCAATGCCCTCCTCGGCAACAGGCAA
GTCGCCTACTCGAGTAAGAAACCGGGCGCTACCGAATGCCTAAACTCGTATGCCATTGGCGTTGTCACCAAGGAC
ATTGCCCCTCCGCTTCCAGGCGAGCCCACCGCCGGCGTCGTTTCCATACACCCCAAGCGCAAGAGGCGCAGGAGG
CGCAAGAAGAAGAAGAAGCCCGAAATCGTCAGAAACGACCTCATGATGGCCAGCGCGTCGCCCTCGTGCCGCGGC
CTCGTCCTCGTCGACACGCCCGGCTACGGCTTTCGCAGCCGCTTCGCCTTTGGCGATGCCGTTATGCAGTACCTC
GGCCGCCGCCGTCTGCTCCGCGGCGCCATCCTGCTCCTCTCCATCACCAAGAGCAACCCCGTCAGCGAACAGGAC
GAGTGGATCCTGCGCGCCCTCGCCCTCAACGCCACGCCCACCCTCGTCGTCGTTACGAAAATTGACAAAAAGGGC
ATCGAGTGGCCCGACAGGTGCGCCGTCTTTGGCCAGCGTCTCCTCAACGACCTGGACCAAATCAACAAGCAGTCC
GCCCTTGGCAAATGGCGCACGTCGACGGACCAAGACAACCACTCCATTTGGTTCACTGCCTCGCGCCTCAAGGCC
CTTGTCTCCAAGAACTGCGGCATCGCCCACATTCGCAAACTCCTTGTTGAAATGGCCGGCCTCCACGTCCACAAC
GACTCCGTCTGCAACAAGCAAGAAACTATTGAATACAATGGCCCCGTCGTCTCCCACCAAGAGCTGCAAGAAGCC
GCCACCGCCGCCGCCGCACCCCCCATCCCCCAAACTAGTCCAGGCAGACAGCCAAAGGACCGCTCCCGACGCAAG
CCCCTCCCCCGCCAAGACTACCTGCGCATCATGCAAAAGGCCGGGCCCTGGCCCACGATAGGCCCAGATGACCCT
GCTCCAATCACCCCAACCGCCACGGGCTATGCGCCCCCGCCCGAACCCGCCGGGCCTGAACCTAGCCCTGAAATG
GCCTTGAAAAAGGAACAAGAGGACGTAAAGGCTGCGAGACGTGTTTATGCATGGGCCAAGAAGCCCCGTAGGTTG
CGTAGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail