Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1989
Gene name
LocationContig_1656:94..2453
Strand+
Gene length (bp)2359
Transcript length (bp)2163
Coding sequence length (bp)2163
Protein length (aa) 721

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 6.0E-03 56 90
PF00400 WD40 WD domain, G-beta repeat 3.0E-02 121 148
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 5.1E-05 118 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13985|YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.03 PE=1 SV=2 1 566 1.0E-99
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 1 192 5.0E-48
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 1 202 8.0E-42
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 1 202 1.0E-41
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 1 202 3.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13985|YEG3_SCHPO Uncharacterized WD repeat-containing protein C26H5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26H5.03 PE=1 SV=2 1 566 1.0E-99
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 1 192 5.0E-48
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 1 202 8.0E-42
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 1 202 1.0E-41
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 1 202 3.0E-40
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 1 191 3.0E-34
sp|Q9D0N7|CAF1B_MOUSE Chromatin assembly factor 1 subunit B OS=Mus musculus GN=Chaf1b PE=1 SV=1 328 555 5.0E-34
sp|Q9SXY1|FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 1 191 2.0E-33
sp|Q32SG6|HIRA_MAIZE Protein HIRA OS=Zea mays PE=1 SV=1 13 203 3.0E-29
sp|Q652L2|HIRA_ORYSJ Protein HIRA OS=Oryza sativa subsp. japonica GN=Os09g0567700 PE=2 SV=1 13 203 1.0E-28
sp|Q9LXN4|HIRA_ARATH Protein HIRA OS=Arabidopsis thaliana GN=HIRA PE=1 SV=2 13 203 2.0E-27
sp|Q5R1S9|CAF1B_CHICK Chromatin assembly factor 1 subunit B OS=Gallus gallus GN=CHAF1B PE=1 SV=1 328 555 1.0E-26
sp|Q7RZI0|HIR1_NEUCR Protein hir-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=hir-1 PE=3 SV=2 13 190 4.0E-23
sp|Q6C553|HIR1_YARLI Protein HIR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIR1 PE=3 SV=2 17 190 7.0E-23
sp|Q9SXY1|FAS2_ARATH Chromatin assembly factor 1 subunit FAS2 OS=Arabidopsis thaliana GN=FAS2 PE=1 SV=1 328 563 3.0E-22
sp|P79987|HIRA_CHICK Protein HIRA OS=Gallus gallus GN=HIRA PE=1 SV=2 10 199 6.0E-22
sp|Q61666|HIRA_MOUSE Protein HIRA OS=Mus musculus GN=Hira PE=1 SV=3 10 202 8.0E-22
sp|Q6CXX3|HIR1_KLULA Protein HIR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HIR1 PE=3 SV=1 17 278 1.0E-21
sp|Q8QFR2|HIRA_XENLA Protein HIRA OS=Xenopus laevis GN=hira PE=1 SV=2 10 202 1.0E-21
sp|P54198|HIRA_HUMAN Protein HIRA OS=Homo sapiens GN=HIRA PE=1 SV=2 10 202 2.0E-21
sp|Q1DHE1|HIR1_COCIM Protein HIR1 OS=Coccidioides immitis (strain RS) GN=HIR1 PE=3 SV=1 13 252 2.0E-21
sp|Q5BDU4|HIR1_EMENI Protein hir1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hir1 PE=3 SV=2 17 192 7.0E-21
sp|O42611|HIRA_TAKRU Protein HIRA OS=Takifugu rubripes GN=hira PE=2 SV=1 10 199 9.0E-21
sp|Q6FVD3|HIR1_CANGA Protein HIR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HIR1 PE=3 SV=1 13 263 1.0E-20
sp|Q4IBR4|HIR1_GIBZE Protein HIR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HIR1 PE=3 SV=1 13 192 2.0E-20
sp|O17468|HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 29 203 2.0E-20
sp|Q86HX1|HIRA_DICDI Protein HIRA OS=Dictyostelium discoideum GN=hira PE=3 SV=1 17 196 6.0E-20
sp|P0CS38|HIR1_CRYNJ Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HIR1 PE=3 SV=1 17 191 7.0E-20
sp|P0CS39|HIR1_CRYNB Protein HIR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HIR1 PE=3 SV=1 17 191 7.0E-20
sp|Q2GSJ9|HIR1_CHAGB Protein HIR1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HIR1 PE=3 SV=1 13 192 1.0E-19
sp|Q2UBU2|HIR1_ASPOR Protein HIR1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=HIR1 PE=3 SV=1 17 192 1.0E-19
sp|P32479|HIR1_YEAST Protein HIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HIR1 PE=1 SV=3 29 203 4.0E-19
sp|Q4P4R3|HIR1_USTMA Protein HIR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HIR1 PE=3 SV=1 29 196 4.0E-18
sp|P87314|HIR1_SCHPO Protein hir1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hip1 PE=1 SV=1 17 192 4.0E-18
sp|Q0UNC6|HIR1_PHANO Protein HIR1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HIR1 PE=3 SV=1 13 256 5.0E-18
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 485 555 2.0E-17
sp|Q4WTC4|HIR1_ASPFU Protein hir1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hir1 PE=3 SV=1 32 192 2.0E-17
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 482 549 2.0E-16
sp|Q6BYU4|HIR1_DEBHA Protein HIR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HIR1 PE=3 SV=2 29 195 2.0E-16
sp|Q5ACW8|HIR1_CANAL Protein HIR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HIR1 PE=3 SV=1 56 199 3.0E-16
sp|Q74ZN0|HIR1_ASHGO Protein HIR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HIR1 PE=3 SV=2 13 203 1.0E-15
sp|Q0CQ54|HIR1_ASPTN Protein hir1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=hir1 PE=3 SV=1 17 192 3.0E-15
sp|Q13112|CAF1B_HUMAN Chromatin assembly factor 1 subunit B OS=Homo sapiens GN=CHAF1B PE=1 SV=1 141 413 1.0E-13
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 485 555 2.0E-12
sp|Q6ZD63|FAS2_ORYSJ Chromatin assembly factor 1 subunit FAS2 homolog OS=Oryza sativa subsp. japonica GN=FAS2 PE=2 SV=1 326 415 5.0E-12
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 13 201 2.0E-11
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 13 201 1.0E-10
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 8 198 1.0E-10
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 56 203 2.0E-10
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 10 197 2.0E-10
sp|Q04199|CAC2_YEAST Chromatin assembly factor 1 subunit p60 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAC2 PE=1 SV=1 328 417 3.0E-10
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 39 197 3.0E-10
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 13 201 3.0E-10
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 15 210 5.0E-10
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 17 193 9.0E-10
sp|Q4V8C4|WDR5B_RAT WD repeat-containing protein 5B OS=Rattus norvegicus GN=Wdr5b PE=2 SV=1 58 218 1.0E-09
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 11 201 1.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 17 196 1.0E-09
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 56 194 2.0E-09
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 56 194 2.0E-09
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 30 201 2.0E-09
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 58 217 4.0E-09
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 58 217 4.0E-09
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 58 217 4.0E-09
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 58 217 4.0E-09
sp|Q9D7H2|WDR5B_MOUSE WD repeat-containing protein 5B OS=Mus musculus GN=Wdr5b PE=1 SV=1 58 205 5.0E-09
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 58 217 5.0E-09
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 58 217 5.0E-09
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 56 194 1.0E-08
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 19 205 1.0E-08
sp|Q5ZMC3|WSDU1_CHICK WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 78 207 1.0E-08
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 17 362 1.0E-08
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 56 194 1.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 17 211 2.0E-08
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 57 207 2.0E-08
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 57 207 3.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 190 3.0E-08
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 17 211 4.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 54 194 4.0E-08
sp|Q5AZX0|PFS2_EMENI Polyadenylation factor subunit 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pfs2 PE=3 SV=1 58 207 4.0E-08
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 56 194 4.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 30 191 6.0E-08
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 30 201 6.0E-08
sp|Q09589|HIRA_CAEEL Protein HIRA homolog OS=Caenorhabditis elegans GN=K10D2.1 PE=3 SV=2 67 191 7.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 2 192 1.0E-07
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 14 201 1.0E-07
sp|Q3MHE2|PRP4_BOVIN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Bos taurus GN=PRPF4 PE=2 SV=1 14 201 1.0E-07
sp|Q5NVD0|PRP4_PONAB U4/U6 small nuclear ribonucleoprotein Prp4 OS=Pongo abelii GN=PRPF4 PE=2 SV=1 16 207 1.0E-07
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 28 213 1.0E-07
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 30 196 1.0E-07
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 58 217 2.0E-07
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 17 197 2.0E-07
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 56 194 2.0E-07
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 30 198 2.0E-07
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 17 211 2.0E-07
sp|Q9DAW6|PRP4_MOUSE U4/U6 small nuclear ribonucleoprotein Prp4 OS=Mus musculus GN=Prpf4 PE=1 SV=1 14 201 2.0E-07
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 30 198 2.0E-07
sp|Q2GSM6|SEC13_CHAGB Protein transport protein SEC13 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SEC13 PE=3 SV=1 30 191 3.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 30 207 3.0E-07
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 30 196 3.0E-07
sp|Q4X1Y0|PFS2_ASPFU Polyadenylation factor subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pfs2 PE=3 SV=1 58 207 3.0E-07
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 17 208 4.0E-07
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 30 201 4.0E-07
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 30 196 4.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 56 194 5.0E-07
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 16 90 5.0E-07
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 16 190 5.0E-07
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 56 190 5.0E-07
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 190 6.0E-07
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 29 190 6.0E-07
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 30 198 6.0E-07
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 56 207 6.0E-07
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 56 196 7.0E-07
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 30 196 9.0E-07
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 16 194 1.0E-06
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 17 232 1.0E-06
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 56 196 1.0E-06
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 30 215 1.0E-06
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 59 194 1.0E-06
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 52 218 1.0E-06
sp|Q7RZF5|SEC13_NEUCR Protein transport protein sec13 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nup-20 PE=3 SV=2 30 218 1.0E-06
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 22 195 1.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 29 191 2.0E-06
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 30 194 2.0E-06
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 30 215 2.0E-06
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 30 215 2.0E-06
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 30 212 2.0E-06
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 17 195 2.0E-06
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 13 195 2.0E-06
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3 7 194 2.0E-06
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 71 213 3.0E-06
sp|P62884|GBLP_LEIIN Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania infantum GN=LACK1 PE=2 SV=1 32 211 3.0E-06
sp|P62883|GBLP_LEICH Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania chagasi PE=2 SV=1 32 211 3.0E-06
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 57 190 3.0E-06
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 57 190 3.0E-06
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 17 211 4.0E-06
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 30 190 4.0E-06
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 54 213 4.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 13 195 4.0E-06
sp|Q29RH4|THOC3_BOVIN THO complex subunit 3 OS=Bos taurus GN=THOC3 PE=2 SV=1 30 226 4.0E-06
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 9 194 5.0E-06
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 30 192 5.0E-06
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 30 190 5.0E-06
sp|Q8VE80|THOC3_MOUSE THO complex subunit 3 OS=Mus musculus GN=Thoc3 PE=2 SV=1 30 226 5.0E-06
sp|Q6PBD6|WDR61_XENTR WD repeat-containing protein 61 OS=Xenopus tropicalis GN=wdr61 PE=2 SV=1 36 193 5.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 13 195 5.0E-06
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 56 190 5.0E-06
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 11 192 5.0E-06
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 56 190 5.0E-06
sp|Q25306|GBLP_LEIMA Guanine nucleotide-binding protein subunit beta-like protein OS=Leishmania major PE=2 SV=1 32 202 6.0E-06
sp|Q96J01|THOC3_HUMAN THO complex subunit 3 OS=Homo sapiens GN=THOC3 PE=1 SV=1 30 226 6.0E-06
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 54 213 7.0E-06
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 13 195 7.0E-06
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 11 192 8.0E-06
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 55 194 8.0E-06
sp|Q6C553|HIR1_YARLI Protein HIR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HIR1 PE=3 SV=2 492 572 9.0E-06
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 30 190 9.0E-06
sp|Q9VU68|WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster GN=flr PE=2 SV=1 13 172 9.0E-06
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 30 206 1.0E-05
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 30 206 1.0E-05
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 30 190 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1989
MKATPIIINWHDQNAPVYSAHFEPGPKCRLATAGGDNHVRLWKVDFDDADRRVDYLATLSKHNQAVNVVRWAPKG
EVIASAGDDGNVILWVPSELPSSSFGSESQDDKESWRAKHMCRSSGAEIYDLAWSPDANHFIIGSMDNVARIYSA
NNGTLVRQIAEHSHYVQGVTWDPLNEYIATQSSDRSVHIYSLRTKDGQYTLSHDDKVPRLASHIKADLPPRRISS
SSPAPPDFGHRAQFSAMESSASAASPIASSTPGTPMSFALPMNPPSVVSHSRRSSVSSSHAPSRRSVSPAPSIPL
PAVMPMEPSPKPHSMATSFGLGVKNASLYANETLTSFFRRLTFTPDGSLLLTPSGQYQTQNQSDKDSKPSYEVIN
TVYIYTRGGINKPPIAHLPGHKKPSVVVKCSPIIYTLRQSTASTKHFTIDTSSPEEPIASLPDPIAKPSPATFME
PPPPPSSSSSDHASASSKPQGADADSSMPGPKPAFALAYRMVYAVATQDSVLLYDTQQKSPLCIVSNLHCATFTD
LAWSSDGLTLLISSSDGFCSTLSFLPGDLGDVYKGEIGPPKSTTTTGTPSRTTPTTAASSSLKTPSHFHNGSLHQ
HRNSTSSFAAPSSPASVTPAPQRPSSPARSNSESSVVTQSSLVPGTVISNPPLLAGNMPALTAAGSGKAAGMPMT
SPPETPRSTAGSVTGTKRDVSESDKEENKEPKKRRVAPTPVEPNP*
Coding >OphauG2|1989
ATGAAAGCCACGCCCATCATCATCAATTGGCACGACCAAAACGCTCCTGTATACTCTGCCCACTTCGAGCCCGGC
CCCAAATGCCGTCTTGCTACTGCGGGCGGAGACAACCATGTCCGCCTGTGGAAGGTGGACTTTGACGATGCCGAC
CGCCGTGTTGACTATCTTGCTACGCTTTCCAAGCACAACCAGGCGGTCAATGTGGTCAGATGGGCTCCCAAAGGC
GAGGTAATCGCCTCGGCCGGCGACGACGGCAACGTCATACTCTGGGTCCCCAGTGAGCTCCCGTCCTCGTCCTTT
GGCTCTGAATCTCAAGACGACAAGGAGTCTTGGCGCGCCAAGCACATGTGTCGCTCCAGCGGCGCCGAGATCTAC
GACCTGGCCTGGTCTCCCGACGCCAACCACTTCATCATTGGCAGCATGGACAATGTTGCCCGCATCTACAGTGCC
AATAACGGCACCCTCGTGCGTCAAATCGCCGAGCATTCCCACTACGTCCAGGGCGTGACGTGGGATCCTCTCAAT
GAGTACATTGCCACCCAATCCTCTGATCGCTCTGTCCACATCTATTCCCTGCGCACAAAGGACGGCCAATACACG
CTCAGCCATGACGACAAGGTCCCTCGTCTGGCCAGCCACATCAAGGCAGACCTCCCGCCACGCCGCATTTCCTCG
AGCAGTCCAGCGCCCCCCGACTTCGGCCACAGAGCCCAGTTCTCCGCCATGGAGTCGAGTGCCTCGGCTGCATCC
CCCATTGCATCATCCACCCCAGGAACCCCCATGTCATTTGCCCTGCCCATGAACCCGCCTAGTGTCGTCAGTCAC
AGCCGCCGCTCGTCCGTCTCGTCGTCTCACGCCCCCTCTCGACGCTCCGTGTCGCCTGCACCTTCGATACCGCTT
CCCGCCGTGATGCCCATGGAGCCGTCGCCAAAGCCTCATTCCATGGCTACAAGCTTTGGACTAGGTGTCAAGAAC
GCCTCCTTGTACGCCAATGAGACTCTCACATCCTTTTTTCGCCGCCTCACTTTTACCCCCGACGGCAGTCTGCTC
TTGACCCCCTCAGGACAGTACCAGACGCAGAACCAGTCCGACAAGGACTCAAAACCGAGCTACGAAGTCATCAAC
ACTGTCTATATTTACACCCGAGGTGGAATCAACAAGCCCCCCATTGCTCACTTACCCGGGCACAAGAAGCCGTCA
GTCGTGGTCAAGTGCTCACCCATAATCTACACGCTTCGCCAGTCTACAGCCTCGACCAAACACTTTACCATTGAC
ACATCATCTCCAGAAGAGCCAATTGCGTCGTTGCCGGATCCAATTGCCAAGCCGTCTCCTGCCACGTTTATGGAA
CCTCCTCCACCCCCATCAAGTTCATCGTCAGACCACGCCTCTGCATCATCAAAACCGCAGGGCGCTGATGCAGAT
TCATCCATGCCAGGCCCCAAACCCGCTTTTGCCTTGGCATATCGCATGGTTTATGCAGTTGCCACACAGGACTCG
GTGCTCTTGTACGACACACAACAAAAGTCGCCTCTTTGCATTGTTAGCAACTTGCACTGCGCCACTTTTACTGAT
CTTGCGTGGTCTAGCGACGGTCTGACGCTGCTCATATCCTCGTCTGACGGATTCTGCTCGACCTTGTCGTTTCTT
CCAGGCGATTTGGGAGATGTTTACAAGGGAGAAATAGGTCCGCCCAAGAGCACAACAACAACTGGCACGCCAAGT
CGCACGACGCCAACGACAGCCGCCAGCAGCAGCTTGAAAACGCCATCTCATTTCCACAATGGAAGTCTTCACCAG
CACCGCAACTCGACCAGCTCGTTTGCAGCTCCATCGTCGCCAGCTTCGGTGACGCCTGCGCCACAGCGCCCATCT
TCACCGGCCAGGTCCAACTCTGAATCATCCGTGGTGACACAGTCGTCCCTGGTGCCCGGCACGGTAATAAGCAAT
CCGCCCCTCCTTGCCGGAAATATGCCAGCCCTTACAGCCGCTGGCAGTGGCAAGGCAGCGGGCATGCCCATGACG
AGTCCTCCAGAAACACCTCGGAGCACTGCGGGAAGTGTTACAGGGACAAAGAGAGACGTGAGCGAAAGCGACAAG
GAAGAGAACAAAGAGCCCAAGAAGAGGCGAGTGGCGCCAACACCTGTTGAGCCGAACCCATGA
Transcript >OphauG2|1989
ATGAAAGCCACGCCCATCATCATCAATTGGCACGACCAAAACGCTCCTGTATACTCTGCCCACTTCGAGCCCGGC
CCCAAATGCCGTCTTGCTACTGCGGGCGGAGACAACCATGTCCGCCTGTGGAAGGTGGACTTTGACGATGCCGAC
CGCCGTGTTGACTATCTTGCTACGCTTTCCAAGCACAACCAGGCGGTCAATGTGGTCAGATGGGCTCCCAAAGGC
GAGGTAATCGCCTCGGCCGGCGACGACGGCAACGTCATACTCTGGGTCCCCAGTGAGCTCCCGTCCTCGTCCTTT
GGCTCTGAATCTCAAGACGACAAGGAGTCTTGGCGCGCCAAGCACATGTGTCGCTCCAGCGGCGCCGAGATCTAC
GACCTGGCCTGGTCTCCCGACGCCAACCACTTCATCATTGGCAGCATGGACAATGTTGCCCGCATCTACAGTGCC
AATAACGGCACCCTCGTGCGTCAAATCGCCGAGCATTCCCACTACGTCCAGGGCGTGACGTGGGATCCTCTCAAT
GAGTACATTGCCACCCAATCCTCTGATCGCTCTGTCCACATCTATTCCCTGCGCACAAAGGACGGCCAATACACG
CTCAGCCATGACGACAAGGTCCCTCGTCTGGCCAGCCACATCAAGGCAGACCTCCCGCCACGCCGCATTTCCTCG
AGCAGTCCAGCGCCCCCCGACTTCGGCCACAGAGCCCAGTTCTCCGCCATGGAGTCGAGTGCCTCGGCTGCATCC
CCCATTGCATCATCCACCCCAGGAACCCCCATGTCATTTGCCCTGCCCATGAACCCGCCTAGTGTCGTCAGTCAC
AGCCGCCGCTCGTCCGTCTCGTCGTCTCACGCCCCCTCTCGACGCTCCGTGTCGCCTGCACCTTCGATACCGCTT
CCCGCCGTGATGCCCATGGAGCCGTCGCCAAAGCCTCATTCCATGGCTACAAGCTTTGGACTAGGTGTCAAGAAC
GCCTCCTTGTACGCCAATGAGACTCTCACATCCTTTTTTCGCCGCCTCACTTTTACCCCCGACGGCAGTCTGCTC
TTGACCCCCTCAGGACAGTACCAGACGCAGAACCAGTCCGACAAGGACTCAAAACCGAGCTACGAAGTCATCAAC
ACTGTCTATATTTACACCCGAGGTGGAATCAACAAGCCCCCCATTGCTCACTTACCCGGGCACAAGAAGCCGTCA
GTCGTGGTCAAGTGCTCACCCATAATCTACACGCTTCGCCAGTCTACAGCCTCGACCAAACACTTTACCATTGAC
ACATCATCTCCAGAAGAGCCAATTGCGTCGTTGCCGGATCCAATTGCCAAGCCGTCTCCTGCCACGTTTATGGAA
CCTCCTCCACCCCCATCAAGTTCATCGTCAGACCACGCCTCTGCATCATCAAAACCGCAGGGCGCTGATGCAGAT
TCATCCATGCCAGGCCCCAAACCCGCTTTTGCCTTGGCATATCGCATGGTTTATGCAGTTGCCACACAGGACTCG
GTGCTCTTGTACGACACACAACAAAAGTCGCCTCTTTGCATTGTTAGCAACTTGCACTGCGCCACTTTTACTGAT
CTTGCGTGGTCTAGCGACGGTCTGACGCTGCTCATATCCTCGTCTGACGGATTCTGCTCGACCTTGTCGTTTCTT
CCAGGCGATTTGGGAGATGTTTACAAGGGAGAAATAGGTCCGCCCAAGAGCACAACAACAACTGGCACGCCAAGT
CGCACGACGCCAACGACAGCCGCCAGCAGCAGCTTGAAAACGCCATCTCATTTCCACAATGGAAGTCTTCACCAG
CACCGCAACTCGACCAGCTCGTTTGCAGCTCCATCGTCGCCAGCTTCGGTGACGCCTGCGCCACAGCGCCCATCT
TCACCGGCCAGGTCCAACTCTGAATCATCCGTGGTGACACAGTCGTCCCTGGTGCCCGGCACGGTAATAAGCAAT
CCGCCCCTCCTTGCCGGAAATATGCCAGCCCTTACAGCCGCTGGCAGTGGCAAGGCAGCGGGCATGCCCATGACG
AGTCCTCCAGAAACACCTCGGAGCACTGCGGGAAGTGTTACAGGGACAAAGAGAGACGTGAGCGAAAGCGACAAG
GAAGAGAACAAAGAGCCCAAGAAGAGGCGAGTGGCGCCAACACCTGTTGAGCCGAACCCATGA
Gene >OphauG2|1989
ATGAAAGCCACGCCCATCATCATCAATTGGCACGACCAAAACGCTCCTGTATACTCTGCCCACTTCGAGCCCGGC
CCCAAATGCCGTCTTGCTACTGCGGGCGGAGACAACCATGTCCGCCTGTGGAAGGTGGACTTTGACGATGCCGAC
CGCCGTGTTGACTATCTTGCTACGCTTTCCAAGCACAACCAGGCGGTCAATGTGGTCAGATGGGCTCCCAAAGGT
AGTCGTTTCTCGCCCTTTGTCTTCCGTGCCCTTGGTCCTGCTGACTCGGCCCGCAATGGCAGGCGAGGTAATCGC
CTCGGCCGGCGACGACGGCAACGTCATACTCTGGGTCCCCAGTGAGCTCCCGTCCTCGTCCTTTGGCTCTGAATC
TCAAGACGACAAGGAGTCTTGGCGCGCCAAGCACATGTGTCGCTCCAGCGGCGCCGAGATCTACGACCTGGCCTG
GTCTCCCGACGCCAACCACTTCATCATTGGCAGCATGGACAATGTTGCCCGCATCTACAGTGCCAATAACGGTAA
GGGCTTGGCTACCCTGTCGCTTGCTGACGACTGACACACGTGTCGCCACCAGGCACCCTCGTGCGTCAAATCGCC
GAGCATTCCCACTACGTCCAGGGCGTGACGTGGGATCCTCTCAATGAGTACATTGCCACCCAATCCTCTGATCGC
TCTGTCCACATCTATTCCCTGCGCACAAAGGACGGCCAATACACGCTCAGCCATGACGACAAGGTCCCTCGTCTG
GCCAGCCACATCAAGGCAGACCTCCCGCCACGCCGCATTTCCTCGAGCAGTCCAGCGCCCCCCGACTTCGGCCAC
AGAGCCCAGTTCTCCGCCATGGAGTCGAGTGCCTCGGCTGCATCCCCCATTGCATCATCCACCCCAGGAACCCCC
ATGTCATTTGCCCTGCCCATGAACCCGCCTAGTGTCGTCAGTCACAGCCGCCGCTCGTCCGTCTCGTCGTCTCAC
GCCCCCTCTCGACGCTCCGTGTCGCCTGCACCTTCGATACCGCTTCCCGCCGTGATGCCCATGGAGCCGTCGCCA
AAGCCTCATTCCATGGCTACAAGCTTTGGACTAGGTGTCAAGAACGCCTCCTTGTACGCCAATGAGACTCTCACA
TCCTTTTTTCGCCGCCTCACTTTTACCCCCGACGGCAGTCTGCTCTTGACCCCCTCAGGACAGTACCAGACGCAG
AACCAGTCCGACAAGGACTCAAAACCGAGCTACGAAGTCATCAACACTGTCTATATTTACACCCGAGGTGGAATC
AACAAGCCCCCCATTGCTCACTTACCCGGGCACAAGAAGCCGTCAGTCGTGGTCAAGTGCTCACCCATAATCTAC
ACGCTTCGCCAGTCTACAGCCTCGACCAAACACTTTACCATTGACACATCATCTCCAGAAGAGCCAATTGCGTCG
TTGCCGGATCCAATTGCCAAGCCGTCTCCTGCCACGTTTATGGAACCTCCTCCACCCCCATCAAGTTCATCGTCA
GACCACGCCTCTGCATCATCAAAACCGCAGGGCGCTGATGCAGATTCATCCATGCCAGGCCCCAAACCCGCTTTT
GCCTTGGCATATCGCATGGTTTATGCAGTTGCCACACAGGACTCGGTGCTCTTGTACGACACACAACAAAAGTCG
CCTCTTTGCATTGTTAGCAACTTGCACTGCGCCACTTTTACTGATCTTGCGTGGTATAGTCAAGCCCAGTCATTA
TTGGTCGGGTTGAATGTTGAAAGTGGCTGACACGGTGAACCCTAAAAAATACAGGTCTAGCGACGGTCTGACGCT
GCTCATATCCTCGTCTGACGGATTCTGCTCGACCTTGTCGTTTCTTCCAGGCGATTTGGGAGATGTTTACAAGGG
AGAAATAGGTCCGCCCAAGAGCACAACAACAACTGGCACGCCAAGTCGCACGACGCCAACGACAGCCGCCAGCAG
CAGCTTGAAAACGCCATCTCATTTCCACAATGGAAGTCTTCACCAGCACCGCAACTCGACCAGCTCGTTTGCAGC
TCCATCGTCGCCAGCTTCGGTGACGCCTGCGCCACAGCGCCCATCTTCACCGGCCAGGTCCAACTCTGAATCATC
CGTGGTGACACAGTCGTCCCTGGTGCCCGGCACGGTAATAAGCAATCCGCCCCTCCTTGCCGGAAATATGCCAGC
CCTTACAGCCGCTGGCAGTGGCAAGGCAGCGGGCATGCCCATGACGAGTCCTCCAGAAACACCTCGGAGCACTGC
GGGAAGTGTTACAGGGACAAAGAGAGACGTGAGCGAAAGCGACAAGGAAGAGAACAAAGAGCCCAAGAAGAGGCG
AGTGGCGCCAACACCTGTTGAGCCGAACCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail