Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1984
Gene name
LocationContig_1650:114..2027
Strand+
Gene length (bp)1913
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00012 HSP70 Hsp70 protein 3.6E-08 28 395

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 28 437 3.0E-11
sp|Q30Q10|DNAK_SULDN Chaperone protein DnaK OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dnaK PE=3 SV=1 28 437 5.0E-11
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 28 437 6.0E-11
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 28 437 1.0E-10
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 28 437 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B9KCH0|DNAK_CAMLR Chaperone protein DnaK OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=dnaK PE=3 SV=1 28 437 3.0E-11
sp|Q30Q10|DNAK_SULDN Chaperone protein DnaK OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=dnaK PE=3 SV=1 28 437 5.0E-11
sp|B4SDA0|DNAK_PELPB Chaperone protein DnaK OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=dnaK PE=3 SV=1 28 437 6.0E-11
sp|Q0BW82|DNAK_GRABC Chaperone protein DnaK OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=dnaK PE=3 SV=1 28 437 1.0E-10
sp|A1BET8|DNAK_CHLPD Chaperone protein DnaK OS=Chlorobium phaeobacteroides (strain DSM 266) GN=dnaK PE=3 SV=1 28 437 2.0E-10
sp|Q3B577|DNAK_CHLL7 Chaperone protein DnaK OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=dnaK PE=3 SV=1 28 437 2.0E-10
sp|Q15WH0|HSCA_PSEA6 Chaperone protein HscA homolog OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=hscA PE=3 SV=1 24 395 4.0E-10
sp|Q2RNE6|DNAK_RHORT Chaperone protein DnaK OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=dnaK PE=3 SV=1 28 437 4.0E-10
sp|Q3APD2|DNAK_CHLCH Chaperone protein DnaK OS=Chlorobium chlorochromatii (strain CaD3) GN=dnaK PE=3 SV=1 28 437 4.0E-10
sp|Q5HV33|DNAK_CAMJR Chaperone protein DnaK OS=Campylobacter jejuni (strain RM1221) GN=dnaK PE=3 SV=1 28 437 4.0E-10
sp|A8FLH2|DNAK_CAMJ8 Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dnaK PE=3 SV=1 28 437 4.0E-10
sp|A6Q421|DNAK_NITSB Chaperone protein DnaK OS=Nitratiruptor sp. (strain SB155-2) GN=dnaK PE=3 SV=1 28 437 5.0E-10
sp|A7H484|DNAK_CAMJD Chaperone protein DnaK OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaK PE=3 SV=1 28 437 5.0E-10
sp|A5FZ19|DNAK_ACICJ Chaperone protein DnaK OS=Acidiphilium cryptum (strain JF-5) GN=dnaK PE=3 SV=1 28 437 7.0E-10
sp|A7ZEB5|DNAK_CAMC1 Chaperone protein DnaK OS=Campylobacter concisus (strain 13826) GN=dnaK PE=3 SV=1 28 437 8.0E-10
sp|O69298|DNAK_CAMJE Chaperone protein DnaK OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaK PE=3 SV=1 28 437 1.0E-09
sp|Q9ZMW4|DNAK_HELPJ Chaperone protein DnaK OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaK PE=3 SV=3 28 437 1.0E-09
sp|A4SFB1|DNAK_CHLPM Chaperone protein DnaK OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=dnaK PE=3 SV=1 28 437 1.0E-09
sp|Q7MA35|DNAK_WOLSU Chaperone protein DnaK OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaK PE=3 SV=1 28 437 2.0E-09
sp|A9HEA3|DNAK_GLUDA Chaperone protein DnaK OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=dnaK PE=3 SV=1 28 437 2.0E-09
sp|Q98DD1|DNAK_RHILO Chaperone protein DnaK OS=Rhizobium loti (strain MAFF303099) GN=dnaK PE=3 SV=1 28 395 2.0E-09
sp|Q17VY4|DNAK_HELAH Chaperone protein DnaK OS=Helicobacter acinonychis (strain Sheeba) GN=dnaK PE=3 SV=1 28 437 3.0E-09
sp|A0RPW7|DNAK_CAMFF Chaperone protein DnaK OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=dnaK PE=3 SV=1 28 437 5.0E-09
sp|A5UBQ1|DNAK_HAEIE Chaperone protein DnaK OS=Haemophilus influenzae (strain PittEE) GN=dnaK PE=3 SV=1 28 437 5.0E-09
sp|A8GR49|HSCA_RICRS Chaperone protein HscA homolog OS=Rickettsia rickettsii (strain Sheila Smith) GN=hscA PE=3 SV=1 24 400 6.0E-09
sp|B0BWJ7|HSCA_RICRO Chaperone protein HscA homolog OS=Rickettsia rickettsii (strain Iowa) GN=hscA PE=3 SV=1 24 400 6.0E-09
sp|B8F7S6|DNAK_HAEPS Chaperone protein DnaK OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaK PE=3 SV=1 28 395 7.0E-09
sp|B3EHR1|DNAK_CHLL2 Chaperone protein DnaK OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=dnaK PE=3 SV=1 28 437 8.0E-09
sp|C4K0Z7|HSCA_RICPU Chaperone protein HscA homolog OS=Rickettsia peacockii (strain Rustic) GN=hscA PE=3 SV=1 24 400 8.0E-09
sp|P43736|DNAK_HAEIN Chaperone protein DnaK OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaK PE=3 SV=2 28 437 8.0E-09
sp|Q4QJW4|DNAK_HAEI8 Chaperone protein DnaK OS=Haemophilus influenzae (strain 86-028NP) GN=dnaK PE=3 SV=1 28 437 8.0E-09
sp|A7GXU4|DNAK_CAMC5 Chaperone protein DnaK OS=Campylobacter curvus (strain 525.92) GN=dnaK PE=3 SV=1 28 437 8.0E-09
sp|C3PMP2|HSCA_RICAE Chaperone protein HscA homolog OS=Rickettsia africae (strain ESF-5) GN=hscA PE=3 SV=1 24 400 1.0E-08
sp|Q1MPW1|DNAK_LAWIP Chaperone protein DnaK OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=dnaK PE=3 SV=1 28 395 1.0E-08
sp|Q3ZYV1|DNAK_DEHMC Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain CBDB1) GN=dnaK PE=3 SV=1 28 395 1.0E-08
sp|P55994|DNAK_HELPY Chaperone protein DnaK OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaK PE=3 SV=2 28 437 1.0E-08
sp|A5FPU4|DNAK_DEHMB Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=dnaK PE=3 SV=1 28 395 1.0E-08
sp|Q92J07|HSCA_RICCN Chaperone protein HscA homolog OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=hscA PE=3 SV=1 24 400 1.0E-08
sp|B2URT8|DNAK_HELPS Chaperone protein DnaK OS=Helicobacter pylori (strain Shi470) GN=dnaK PE=3 SV=1 28 437 2.0E-08
sp|Q9W6Y1|HSP7C_ORYLA Heat shock cognate 71 kDa protein OS=Oryzias latipes GN=hsc70 PE=2 SV=1 29 437 2.0E-08
sp|Q5FSL5|DNAK_GLUOX Chaperone protein DnaK OS=Gluconobacter oxydans (strain 621H) GN=dnaK PE=3 SV=1 28 437 2.0E-08
sp|Q1CV46|DNAK_HELPH Chaperone protein DnaK OS=Helicobacter pylori (strain HPAG1) GN=dnaK PE=3 SV=1 28 437 2.0E-08
sp|B5Z9P0|DNAK_HELPG Chaperone protein DnaK OS=Helicobacter pylori (strain G27) GN=dnaK PE=3 SV=1 28 437 2.0E-08
sp|A5UF68|DNAK_HAEIG Chaperone protein DnaK OS=Haemophilus influenzae (strain PittGG) GN=dnaK PE=3 SV=1 28 437 2.0E-08
sp|B6JPL0|DNAK_HELP2 Chaperone protein DnaK OS=Helicobacter pylori (strain P12) GN=dnaK PE=3 SV=1 28 437 2.0E-08
sp|O52064|DNAK_MANHA Chaperone protein DnaK OS=Mannheimia haemolytica GN=dnaK PE=3 SV=1 28 437 3.0E-08
sp|A7HZ39|DNAK_PARL1 Chaperone protein DnaK OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=dnaK PE=3 SV=1 28 395 4.0E-08
sp|P08418|HSP70_SCHMA Heat shock 70 kDa protein homolog OS=Schistosoma mansoni PE=2 SV=2 29 437 4.0E-08
sp|B7GKC8|DNAK_ANOFW Chaperone protein DnaK OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=dnaK PE=3 SV=1 28 396 4.0E-08
sp|Q1RJ70|HSCA_RICBR Chaperone protein HscA homolog OS=Rickettsia bellii (strain RML369-C) GN=hscA PE=3 SV=1 16 235 5.0E-08
sp|Q27031|HSP70_THEPA Heat shock 70 kDa protein OS=Theileria parva GN=TP02_0148 PE=2 SV=2 29 273 7.0E-08
sp|Q8KEP3|DNAK_CHLTE Chaperone protein DnaK OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=dnaK PE=3 SV=1 28 437 8.0E-08
sp|B5EC42|DNAK_GEOBB Chaperone protein DnaK OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=dnaK PE=3 SV=1 28 437 8.0E-08
sp|B0BTI7|DNAK_ACTPJ Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaK PE=3 SV=1 28 437 9.0E-08
sp|A3N3K0|DNAK_ACTP2 Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaK PE=3 SV=1 28 437 9.0E-08
sp|Q313S2|DNAK_DESAG Chaperone protein DnaK OS=Desulfovibrio alaskensis (strain G20) GN=dnaK PE=3 SV=1 154 395 9.0E-08
sp|B3H2X7|DNAK_ACTP7 Chaperone protein DnaK OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dnaK PE=3 SV=1 28 437 9.0E-08
sp|A7I2D4|DNAK_CAMHC Chaperone protein DnaK OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaK PE=3 SV=1 28 437 9.0E-08
sp|Q8Y0L9|HSCA_RALSO Chaperone protein HscA homolog OS=Ralstonia solanacearum (strain GMI1000) GN=hscA PE=3 SV=1 24 240 1.0E-07
sp|A5GDC8|DNAK_GEOUR Chaperone protein DnaK OS=Geobacter uraniireducens (strain Rf4) GN=dnaK PE=3 SV=1 28 437 1.0E-07
sp|P08108|HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss GN=hsc71 PE=2 SV=2 29 437 1.0E-07
sp|P46587|HSP72_CANAL Heat shock protein SSA2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SSA2 PE=1 SV=3 29 437 1.0E-07
sp|Q7NZ33|HSCA_CHRVO Chaperone protein HscA homolog OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=hscA PE=3 SV=1 24 240 2.0E-07
sp|Q3Z6P1|DNAK_DEHM1 Chaperone protein DnaK OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=dnaK PE=3 SV=1 28 395 2.0E-07
sp|B3QMB2|DNAK_CHLP8 Chaperone protein DnaK OS=Chlorobaculum parvum (strain NCIB 8327) GN=dnaK PE=3 SV=1 28 437 2.0E-07
sp|B3QZ38|DNAK_CHLT3 Chaperone protein DnaK OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=dnaK PE=3 SV=1 28 235 2.0E-07
sp|B8FGS3|DNAK_DESAA Chaperone protein DnaK OS=Desulfatibacillum alkenivorans (strain AK-01) GN=dnaK PE=3 SV=1 28 395 2.0E-07
sp|A4G782|HSCA_HERAR Chaperone protein HscA homolog OS=Herminiimonas arsenicoxydans GN=hscA PE=3 SV=1 24 240 2.0E-07
sp|P48209|DNAK_HAEDU Chaperone protein DnaK OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaK PE=3 SV=2 28 395 3.0E-07
sp|Q03WI2|DNAK_LEUMM Chaperone protein DnaK OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=dnaK PE=3 SV=1 28 379 3.0E-07
sp|C6E643|DNAK_GEOSM Chaperone protein DnaK OS=Geobacter sp. (strain M21) GN=dnaK PE=3 SV=1 28 437 3.0E-07
sp|A8IPT1|DNAK_AZOC5 Chaperone protein DnaK OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaK PE=3 SV=1 28 396 3.0E-07
sp|P09435|HSP73_YEAST Heat shock protein SSA3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA3 PE=1 SV=3 29 439 3.0E-07
sp|Q4UKL3|HSCA_RICFE Chaperone protein HscA homolog OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hscA PE=3 SV=1 24 394 3.0E-07
sp|Q5B0C0|HSP7M_EMENI Heat shock 70 kDa protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN6010 PE=1 SV=1 28 437 3.0E-07
sp|Q04EE1|DNAK_OENOB Chaperone protein DnaK OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=dnaK PE=3 SV=1 28 437 4.0E-07
sp|A1B4E9|DNAK_PARDP Chaperone protein DnaK OS=Paracoccus denitrificans (strain Pd 1222) GN=dnaK PE=3 SV=1 28 395 4.0E-07
sp|Q39PT7|DNAK_GEOMG Chaperone protein DnaK OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=dnaK PE=3 SV=1 28 437 4.0E-07
sp|B8DRD6|DNAK_DESVM Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=dnaK PE=3 SV=1 28 395 4.0E-07
sp|Q74H59|DNAK_GEOSL Chaperone protein DnaK OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=dnaK PE=3 SV=1 28 437 6.0E-07
sp|P22202|HSP74_YEAST Heat shock protein SSA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSA4 PE=1 SV=3 29 442 7.0E-07
sp|C4L8Y5|DNAK_TOLAT Chaperone protein DnaK OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaK PE=3 SV=1 28 446 7.0E-07
sp|Q9RY23|DNAK_DEIRA Chaperone protein DnaK OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaK PE=1 SV=3 29 412 8.0E-07
sp|A6UEY0|DNAK_SINMW Chaperone protein DnaK OS=Sinorhizobium medicae (strain WSM419) GN=dnaK PE=3 SV=1 28 395 8.0E-07
sp|Q3IFG5|HSCA_PSEHT Chaperone protein HscA homolog OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=hscA PE=3 SV=1 26 235 9.0E-07
sp|Q2SSB0|DNAK_MYCCT Chaperone protein DnaK OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=dnaK PE=3 SV=1 28 437 1.0E-06
sp|P42374|DNAK_RHIME Chaperone protein DnaK OS=Rhizobium meliloti (strain 1021) GN=dnaK PE=3 SV=2 28 395 1.0E-06
sp|B3E7W9|DNAK_GEOLS Chaperone protein DnaK OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=dnaK PE=3 SV=1 28 396 1.0E-06
sp|B9M357|DNAK_GEODF Chaperone protein DnaK OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=dnaK PE=3 SV=1 150 437 1.0E-06
sp|Q6MT06|DNAK_MYCMS Chaperone protein DnaK OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=dnaK PE=3 SV=1 28 379 1.0E-06
sp|B2GBQ5|DNAK_LACF3 Chaperone protein DnaK OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaK PE=3 SV=1 28 235 1.0E-06
sp|Q3IYM7|DNAK_RHOS4 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=dnaK PE=3 SV=1 28 395 1.0E-06
sp|B5ENA3|DNAK_ACIF5 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaK PE=3 SV=1 28 445 1.0E-06
sp|B7J7X9|DNAK_ACIF2 Chaperone protein DnaK OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaK PE=3 SV=1 28 445 1.0E-06
sp|B4EZU4|HSCA_PROMH Chaperone protein HscA OS=Proteus mirabilis (strain HI4320) GN=hscA PE=3 SV=1 24 235 1.0E-06
sp|Q1WUE8|DNAK_LACS1 Chaperone protein DnaK OS=Lactobacillus salivarius (strain UCC118) GN=dnaK PE=3 SV=1 28 379 2.0E-06
sp|A6SXE9|HSCA_JANMA Chaperone protein HscA homolog OS=Janthinobacterium sp. (strain Marseille) GN=hscA PE=3 SV=1 24 240 2.0E-06
sp|A3PNM1|DNAK_RHOS1 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=dnaK PE=3 SV=1 28 395 2.0E-06
sp|A4WW89|DNAK_RHOS5 Chaperone protein DnaK OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=dnaK PE=3 SV=1 28 395 2.0E-06
sp|A1U614|DNAK_MARHV Chaperone protein DnaK OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=dnaK PE=3 SV=1 28 437 2.0E-06
sp|A0AIS4|DNAK_LISW6 Chaperone protein DnaK OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaK PE=3 SV=1 28 395 2.0E-06
sp|P94695|DNAK_DEIPM Chaperone protein DnaK OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaK PE=3 SV=2 29 396 3.0E-06
sp|P57870|DNAK_PASMU Chaperone protein DnaK OS=Pasteurella multocida (strain Pm70) GN=dnaK PE=3 SV=1 28 397 4.0E-06
sp|Q6G554|DNAK_BARHE Chaperone protein DnaK OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaK PE=3 SV=1 28 437 4.0E-06
sp|P20442|DNAK_CAUCR Chaperone protein DnaK OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaK PE=2 SV=2 28 395 4.0E-06
sp|P50019|DNAK_AGRFC Chaperone protein DnaK OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dnaK PE=2 SV=2 28 395 4.0E-06
sp|A1VFG6|DNAK_DESVV Chaperone protein DnaK OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaK PE=3 SV=1 154 396 4.0E-06
sp|Q72DW8|DNAK_DESVH Chaperone protein DnaK OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaK PE=3 SV=1 154 396 4.0E-06
sp|B3GXS0|HSCA_ACTP7 Chaperone protein HscA homolog OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=hscA PE=3 SV=1 24 235 4.0E-06
sp|B9JZ87|DNAK_AGRVS Chaperone protein DnaK OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaK PE=3 SV=1 150 395 4.0E-06
sp|O05700|DNAK_RHOS7 Chaperone protein DnaK OS=Rhodopseudomonas sp. (strain No.7) GN=dnaK PE=3 SV=1 133 396 5.0E-06
sp|Q835R7|DNAK_ENTFA Chaperone protein DnaK OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaK PE=3 SV=1 28 379 5.0E-06
sp|Q11KJ6|DNAK_CHESB Chaperone protein DnaK OS=Chelativorans sp. (strain BNC1) GN=dnaK PE=3 SV=1 28 396 5.0E-06
sp|B3Q972|DNAK_RHOPT Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain TIE-1) GN=dnaK PE=3 SV=1 133 396 5.0E-06
sp|Q6NCY4|DNAK_RHOPA Chaperone protein DnaK OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=dnaK PE=3 SV=1 133 396 5.0E-06
sp|Q8K9Y8|DNAK_BUCAP Chaperone protein DnaK OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaK PE=3 SV=1 28 395 5.0E-06
sp|Q2LUH6|DNAK_SYNAS Chaperone protein DnaK OS=Syntrophus aciditrophicus (strain SB) GN=dnaK PE=3 SV=1 28 394 5.0E-06
sp|Q8YE76|DNAK_BRUME Chaperone protein DnaK OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dnaK PE=3 SV=2 150 437 5.0E-06
sp|Q05981|DNAK_BRUO2 Chaperone protein DnaK OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=dnaK PE=2 SV=2 150 437 5.0E-06
sp|Q57AD7|DNAK_BRUAB Chaperone protein DnaK OS=Brucella abortus biovar 1 (strain 9-941) GN=dnaK PE=3 SV=1 150 437 5.0E-06
sp|B0BPK8|HSCA_ACTPJ Chaperone protein HscA homolog OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=hscA PE=3 SV=1 24 235 5.0E-06
sp|A3N0T5|HSCA_ACTP2 Chaperone protein HscA homolog OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=hscA PE=3 SV=1 24 235 5.0E-06
sp|C1CZH9|DNAK_DEIDV Chaperone protein DnaK OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=dnaK PE=3 SV=1 29 412 5.0E-06
sp|Q8FXX2|DNAK_BRUSU Chaperone protein DnaK OS=Brucella suis biovar 1 (strain 1330) GN=dnaK PE=3 SV=1 150 437 5.0E-06
sp|A0L4Z2|DNAK_MAGMM Chaperone protein DnaK OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=dnaK PE=3 SV=1 28 445 6.0E-06
sp|B2HZI1|HSCA_ACIBC Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain ACICU) GN=hscA PE=3 SV=1 24 235 8.0E-06
sp|B8J402|DNAK_DESDA Chaperone protein DnaK OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=dnaK PE=3 SV=1 28 395 8.0E-06
sp|B0VD55|HSCA_ACIBY Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AYE) GN=hscA PE=3 SV=1 24 235 8.0E-06
sp|B7I5P9|HSCA_ACIB5 Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AB0057) GN=hscA PE=3 SV=1 24 235 8.0E-06
sp|B7H3H4|HSCA_ACIB3 Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain AB307-0294) GN=hscA PE=3 SV=1 24 235 8.0E-06
sp|B6JCI3|DNAK_OLICO Chaperone protein DnaK OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=dnaK PE=3 SV=1 133 396 8.0E-06
sp|A3M561|HSCA_ACIBT Chaperone protein HscA homolog OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=hscA PE=3 SV=2 24 235 9.0E-06
sp|A9ILH7|DNAK_BART1 Chaperone protein DnaK OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dnaK PE=3 SV=1 28 437 9.0E-06
sp|A1UUC3|DNAK_BARBK Chaperone protein DnaK OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dnaK PE=3 SV=1 28 437 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0140662 ATP-dependent protein folding chaperone Yes
GO:0005524 ATP binding Yes
GO:0140657 ATP-dependent activity No
GO:0044183 protein folding chaperone No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0032555 purine ribonucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1984
MGSSTPASSSEAMSWESGPGSGGRERLIVGVDFGTTFSGVAAAHASAPDDIEIIKTWPGGSSDKVPSEISYEMAG
DGAGQASIRWGFQAKADSSRIRCIKLFLDRTLRLPFYVDNYGTAALLQRCNKQVVDVVSDYLTQLQKHTGAILAR
RYGEAFMASAQIDYVLTCPAVWSDAAKNTTLLAAERAGMGRHSEIQMISEPEAAAVYTLNAIQANCLKVGDNIIV
CDAGGGTVDLISYKILSLRPLRVEESAVGTGGLCGSAFLNYGFEAQVRRKLGAELLHEMKTSRRGDSWQTALNYF
ENVKRSFSDDYEQEWLVPFPRLPADEECGRDAGCLSLTASDMQAIFDPVVKGVCDLVEGQVCKMRRGGGVVSAIV
LVGGFGQSDYLYRRLKDHFGSAAPPPYSERAEWATSLDEGPIEVLQPIYAWTAVVRGAVLRGLQQGSMVVSRRAR
MHYGTSYATTYDEAVHPAGQQYWSQLWERWMIGDRMQWLVAKVSAPSAIC*
Coding >OphauG2|1984
ATGGGCAGCTCGACGCCGGCGAGTTCGAGCGAGGCGATGAGCTGGGAGTCGGGGCCGGGGTCGGGGGGGAGGGAG
CGGTTGATTGTGGGAGTTGATTTTGGGACCACGTTTTCCGGGGTTGCCGCGGCGCATGCGTCGGCGCCAGACGAC
ATTGAAATCATCAAGACATGGCCGGGCGGGTCATCGGACAAGGTGCCGAGCGAGATTTCCTACGAAATGGCGGGT
GACGGGGCCGGGCAAGCCAGCATCCGCTGGGGCTTCCAAGCCAAGGCGGACTCGTCGCGGATCCGATGCATCAAG
CTCTTCCTCGACCGGACGCTTCGACTACCCTTTTACGTGGACAATTACGGCACGGCAGCGCTGCTGCAGCGGTGC
AACAAGCAAGTGGTGGACGTGGTGAGCGACTACCTGACGCAGCTGCAGAAGCACACTGGGGCGATATTGGCGCGG
CGGTACGGCGAGGCGTTTATGGCGTCGGCGCAGATTGACTACGTCTTGACGTGTCCGGCGGTGTGGAGCGATGCG
GCAAAGAACACGACGCTTCTGGCGGCGGAGCGGGCGGGCATGGGGCGGCACTCGGAGATTCAGATGATTAGCGAG
CCCGAGGCGGCGGCGGTGTATACGCTGAATGCGATCCAGGCCAACTGCCTCAAGGTGGGCGACAATATCATTGTG
TGCGATGCGGGAGGGGGGACGGTGGATCTGATTTCATACAAGATTCTGTCGCTGCGGCCGCTGCGGGTGGAAGAG
TCAGCCGTGGGCACGGGCGGGCTGTGCGGCAGCGCCTTTCTCAACTATGGCTTTGAGGCTCAGGTGCGGCGCAAG
CTGGGGGCGGAGCTGCTGCACGAGATGAAGACGAGTCGACGGGGCGACTCGTGGCAGACGGCGCTCAACTATTTT
GAAAACGTCAAGCGGAGCTTCAGCGACGATTACGAGCAAGAGTGGTTGGTGCCATTCCCCAGGCTGCCAGCAGAT
GAAGAATGCGGACGCGACGCGGGCTGCCTGAGCCTGACGGCCAGCGACATGCAGGCCATTTTCGACCCGGTGGTC
AAGGGCGTGTGCGACCTGGTGGAGGGCCAGGTGTGCAAGATGCGACGGGGCGGAGGCGTCGTGTCGGCCATTGTG
CTGGTGGGCGGCTTTGGGCAGAGCGACTACCTGTACCGGCGGCTCAAGGACCATTTTGGCAGTGCGGCGCCGCCG
CCGTATAGCGAGCGGGCCGAGTGGGCAACGAGCCTGGACGAGGGGCCGATTGAGGTGCTGCAGCCGATATACGCG
TGGACGGCGGTGGTGCGAGGGGCGGTGCTTCGAGGCCTCCAGCAGGGCAGCATGGTGGTGTCTCGGCGGGCGAGG
ATGCACTATGGCACGTCGTATGCGACAACGTATGACGAGGCGGTGCATCCGGCGGGACAGCAGTACTGGTCGCAG
CTGTGGGAGCGGTGGATGATTGGGGACCGGATGCAGTGGCTGGTGGCCAAGGTGAGTGCTCCGTCGGCGATCTGT
TGA
Transcript >OphauG2|1984
ATGGGCAGCTCGACGCCGGCGAGTTCGAGCGAGGCGATGAGCTGGGAGTCGGGGCCGGGGTCGGGGGGGAGGGAG
CGGTTGATTGTGGGAGTTGATTTTGGGACCACGTTTTCCGGGGTTGCCGCGGCGCATGCGTCGGCGCCAGACGAC
ATTGAAATCATCAAGACATGGCCGGGCGGGTCATCGGACAAGGTGCCGAGCGAGATTTCCTACGAAATGGCGGGT
GACGGGGCCGGGCAAGCCAGCATCCGCTGGGGCTTCCAAGCCAAGGCGGACTCGTCGCGGATCCGATGCATCAAG
CTCTTCCTCGACCGGACGCTTCGACTACCCTTTTACGTGGACAATTACGGCACGGCAGCGCTGCTGCAGCGGTGC
AACAAGCAAGTGGTGGACGTGGTGAGCGACTACCTGACGCAGCTGCAGAAGCACACTGGGGCGATATTGGCGCGG
CGGTACGGCGAGGCGTTTATGGCGTCGGCGCAGATTGACTACGTCTTGACGTGTCCGGCGGTGTGGAGCGATGCG
GCAAAGAACACGACGCTTCTGGCGGCGGAGCGGGCGGGCATGGGGCGGCACTCGGAGATTCAGATGATTAGCGAG
CCCGAGGCGGCGGCGGTGTATACGCTGAATGCGATCCAGGCCAACTGCCTCAAGGTGGGCGACAATATCATTGTG
TGCGATGCGGGAGGGGGGACGGTGGATCTGATTTCATACAAGATTCTGTCGCTGCGGCCGCTGCGGGTGGAAGAG
TCAGCCGTGGGCACGGGCGGGCTGTGCGGCAGCGCCTTTCTCAACTATGGCTTTGAGGCTCAGGTGCGGCGCAAG
CTGGGGGCGGAGCTGCTGCACGAGATGAAGACGAGTCGACGGGGCGACTCGTGGCAGACGGCGCTCAACTATTTT
GAAAACGTCAAGCGGAGCTTCAGCGACGATTACGAGCAAGAGTGGTTGGTGCCATTCCCCAGGCTGCCAGCAGAT
GAAGAATGCGGACGCGACGCGGGCTGCCTGAGCCTGACGGCCAGCGACATGCAGGCCATTTTCGACCCGGTGGTC
AAGGGCGTGTGCGACCTGGTGGAGGGCCAGGTGTGCAAGATGCGACGGGGCGGAGGCGTCGTGTCGGCCATTGTG
CTGGTGGGCGGCTTTGGGCAGAGCGACTACCTGTACCGGCGGCTCAAGGACCATTTTGGCAGTGCGGCGCCGCCG
CCGTATAGCGAGCGGGCCGAGTGGGCAACGAGCCTGGACGAGGGGCCGATTGAGGTGCTGCAGCCGATATACGCG
TGGACGGCGGTGGTGCGAGGGGCGGTGCTTCGAGGCCTCCAGCAGGGCAGCATGGTGGTGTCTCGGCGGGCGAGG
ATGCACTATGGCACGTCGTATGCGACAACGTATGACGAGGCGGTGCATCCGGCGGGACAGCAGTACTGGTCGCAG
CTGTGGGAGCGGTGGATGATTGGGGACCGGATGCAGTGGCTGGTGGCCAAGGTGAGTGCTCCGTCGGCGATCTGT
TGA
Gene >OphauG2|1984
ATGGGCAGCTCGACGCCGGCGAGTTCGAGCGAGGCGATGAGCTGGGAGTCGGGGCCGGGGTCGGGGGGGAGGGAG
CGGTTGATTGTGGGAGTTGATTTTGGGACCACGTTTTCCGGGTAAGAGGCACTCTTCTTTTTTTTTTCCTTTTCT
TTTCTTTTTCTTTTCTTTTTCTCTTCTTCATTTTTGAAAAGCCATGGGCTATTATAAAAAAAAAGAATAACTGAT
AAAAAAGCCTAGGGTTGCCGCGGCGCATGCGTCGGCGCCAGACGACATTGAAATCATCAAGACATGGCCGGGCGG
GTCATCGGACAAGGTGCCGAGCGAGATTTCCTACGAAATGGCGGGTGACGGGGCCGGGCAAGCCAGCATCCGCTG
GGGCTTCCAAGCCAAGGCGGACTCGTCGCGGATCCGATGCATCAAGCTCTTCCTCGACCGGACGCTTCGACTACC
CTTTTACGTGGACAATTACGGCACGGCAGCGCTGCTGCAGCGGTGCAACAAGCAAGTGGTGGACGTGGTGAGCGA
CTACCTGACGCAGCTGCAGAAGCACACTGGGGCGATATTGGCGCGGCGGTACGGCGAGGCGTTTATGGCGTCGGC
GCAGATTGACTACGTCTTGACGTGTCCGGCGGTGTGGAGCGATGCGGCAAAGAACACGACGCTTCTGGCGGCGGA
GCGGGCGGGCATGGGGCGGCACTCGGAGATTCAGATGATTAGCGAGCCCGAGGCGGCGGCGGTGTATACGCTGAA
TGCGATCCAGGCCAACTGCCTCAAGGTGGGCGACAATATCATTGTGTGCGATGCGGGAGGGGGGACGGTGGAGTG
AGTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTCCCGCCTCGTCGACCACGATTTTTTTTTGTC
TTTGTGAAAATCGTGGTCGGCAAGGGACAAAGAGGCAGCTGCTGACGGAGCCCGGCTACAGTCTGATTTCATACA
AGATTCTGTCGCTGCGGCCGCTGCGGGTGGAAGAGTCAGCCGTGGGCACGGGCGGGCTGTGCGGCAGCGCCTTTC
TCAACTATGGCTTTGAGGCTCAGGTGCGGCGCAAGCTGGGGGCGGAGCTGCTGCACGAGATGAAGACGAGTCGAC
GGGGCGACTCGTGGCAGACGGCGCTCAACTATTTTGAAAACGTCAAGCGGAGCTTCAGCGACGATTACGAGCAAG
AGTGGTTGGTGCCGTGGGTAGAGCCGCTCAGAGCTTTTTTTTTTTTTTTTTTTTTTTTGCCGTGTGTTGAGAGAG
AGTGTTGCTGAGACTGGGCCTTTGTTTGCAGATTCCCCAGGCTGCCAGCAGATGAAGAATGCGGACGCGACGCGG
GCTGCCTGAGCCTGACGGCCAGCGACATGCAGGCCATTTTCGACCCGGTGGTCAAGGGCGTGTGCGACCTGGTGG
AGGGCCAGGTGTGCAAGATGCGACGGGGCGGAGGCGTCGTGTCGGCCATTGTGCTGGTGGGCGGCTTTGGGCAGA
GCGACTACCTGTACCGGCGGCTCAAGGACCATTTTGGCAGTGCGGCGCCGCCGCCGTATAGCGAGCGGGCCGAGT
GGGCAACGAGCCTGGACGAGGGGCCGATTGAGGTGCTGCAGCCGATATACGCGTGGACGGCGGTGGTGCGAGGGG
CGGTGCTTCGAGGCCTCCAGCAGGGCAGCATGGTGGTGTCTCGGCGGGCGAGGATGCACTATGGCACGTCGTATG
CGACAACGTATGACGAGGCGGTGCATCCGGCGGGACAGCAGTACTGGTCGCAGCTGTGGGAGCGGTGGATGATTG
GGGACCGGATGCAGTGGCTGGTGGCCAAGGTGAGTGCTCCGTCGGCGATGTTTTTTTTTTTGGGGGGGGGGGGGG
GTCTCTGAGCAGTCTCATGTAACGCAGCAAGCTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail