Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1963
Gene name
LocationContig_164:15836..16312
Strand+
Gene length (bp)476
Transcript length (bp)411
Coding sequence length (bp)411
Protein length (aa) 137

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01176 eIF-1a Translation initiation factor 1A / IF-1 1.5E-17 26 91

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y803|YN98_SCHPO S1-like domain-containing protein C146.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC146.08c PE=1 SV=1 15 117 8.0E-18
sp|Q8IQ13|EIF1A_DROME Probable RNA-binding protein EIF1AD OS=Drosophila melanogaster GN=CG31957 PE=2 SV=1 25 136 1.0E-11
sp|Q58CY2|EIF1A_BOVIN Probable RNA-binding protein EIF1AD OS=Bos taurus GN=EIF1AD PE=2 SV=1 14 129 9.0E-10
sp|Q6K1L7|EIF1A_CHICK Probable RNA-binding protein EIF1AD OS=Gallus gallus GN=eif1ad PE=2 SV=1 26 112 1.0E-09
sp|Q29MZ0|EIF1A_DROPS Probable RNA-binding protein EIF1AD OS=Drosophila pseudoobscura pseudoobscura GN=GA16587 PE=3 SV=1 26 112 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y803|YN98_SCHPO S1-like domain-containing protein C146.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC146.08c PE=1 SV=1 15 117 8.0E-18
sp|Q8IQ13|EIF1A_DROME Probable RNA-binding protein EIF1AD OS=Drosophila melanogaster GN=CG31957 PE=2 SV=1 25 136 1.0E-11
sp|Q58CY2|EIF1A_BOVIN Probable RNA-binding protein EIF1AD OS=Bos taurus GN=EIF1AD PE=2 SV=1 14 129 9.0E-10
sp|Q6K1L7|EIF1A_CHICK Probable RNA-binding protein EIF1AD OS=Gallus gallus GN=eif1ad PE=2 SV=1 26 112 1.0E-09
sp|Q29MZ0|EIF1A_DROPS Probable RNA-binding protein EIF1AD OS=Drosophila pseudoobscura pseudoobscura GN=GA16587 PE=3 SV=1 26 112 1.0E-09
sp|Q5RD29|EIF1A_PONAB Probable RNA-binding protein EIF1AD OS=Pongo abelii GN=EIF1AD PE=2 SV=1 14 129 2.0E-09
sp|Q5HZM1|EIF1A_XENLA Probable RNA-binding protein EIF1AD OS=Xenopus laevis GN=eif1ad PE=2 SV=1 20 124 1.0E-08
sp|Q4R354|EIF1A_MACFA Probable RNA-binding protein EIF1AD OS=Macaca fascicularis GN=EIF1AD PE=2 SV=1 14 117 1.0E-08
sp|Q8N9N8|EIF1A_HUMAN Probable RNA-binding protein EIF1AD OS=Homo sapiens GN=EIF1AD PE=1 SV=1 14 117 1.0E-08
sp|Q0V9J5|EIF1A_XENTR Probable RNA-binding protein EIF1AD OS=Xenopus tropicalis GN=eif1ad PE=2 SV=1 20 124 2.0E-08
sp|Q5RKI6|EIF1A_RAT Probable RNA-binding protein EIF1AD OS=Rattus norvegicus GN=Eif1ad PE=1 SV=1 14 123 2.0E-08
sp|Q3THJ3|EIF1A_MOUSE Probable RNA-binding protein EIF1AD OS=Mus musculus GN=Eif1ad PE=1 SV=2 14 123 3.0E-08
sp|Q7SY07|EIF1A_DANRE Probable RNA-binding protein EIF1AD OS=Danio rerio GN=eif1ad PE=2 SV=1 5 109 6.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003743 translation initiation factor activity Yes
GO:0006413 translational initiation Yes
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0090079 translation regulator activity, nucleic acid binding No
GO:0045182 translation regulator activity No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0008135 translation factor activity, RNA binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0044237 cellular metabolic process No
GO:0008150 biological_process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5439
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1963 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4609
Ophiocordyceps camponoti-floridani Ophcf2|02900
Ophiocordyceps camponoti-rufipedis Ophun1|5414
Ophiocordyceps kimflemingae Ophio5|5834
Ophiocordyceps subramaniannii Hirsu2|5988

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1963
MGRPKRNVLATAEETLTPPDSLQATQHLARVVKLEGNNLFTCELPDSTRLVLELAQRFRNTIWIKRGGFVLAECY
EGAPSGDSRVEGEIVNVVRDEKLWRKQSYWPKEFAKSSYELNHDQDESNVGKMPPSDSEDE*
Coding >OphauG2|1963
ATGGGCCGCCCCAAGCGCAACGTCCTGGCGACTGCAGAGGAGACACTTACTCCTCCAGATTCTCTGCAAGCCACC
CAGCATCTTGCCCGTGTTGTCAAGCTCGAGGGCAATAATCTCTTCACGTGCGAGTTGCCCGACAGTACTAGGCTC
GTCCTTGAACTTGCACAGCGTTTTCGAAACACAATATGGATCAAGCGTGGCGGCTTTGTCCTAGCTGAGTGCTAT
GAAGGCGCGCCATCAGGTGACTCTCGGGTTGAGGGCGAGATTGTCAATGTAGTGCGCGACGAGAAGCTATGGAGA
AAACAATCTTATTGGCCCAAGGAGTTTGCAAAGTCTTCATATGAATTGAACCATGACCAAGACGAGTCCAATGTC
GGCAAAATGCCCCCTAGCGACTCAGAGGACGAGTAA
Transcript >OphauG2|1963
ATGGGCCGCCCCAAGCGCAACGTCCTGGCGACTGCAGAGGAGACACTTACTCCTCCAGATTCTCTGCAAGCCACC
CAGCATCTTGCCCGTGTTGTCAAGCTCGAGGGCAATAATCTCTTCACGTGCGAGTTGCCCGACAGTACTAGGCTC
GTCCTTGAACTTGCACAGCGTTTTCGAAACACAATATGGATCAAGCGTGGCGGCTTTGTCCTAGCTGAGTGCTAT
GAAGGCGCGCCATCAGGTGACTCTCGGGTTGAGGGCGAGATTGTCAATGTAGTGCGCGACGAGAAGCTATGGAGA
AAACAATCTTATTGGCCCAAGGAGTTTGCAAAGTCTTCATATGAATTGAACCATGACCAAGACGAGTCCAATGTC
GGCAAAATGCCCCCTAGCGACTCAGAGGACGAGTAA
Gene >OphauG2|1963
ATGGGCCGCCCCAAGCGCAACGTCCTGGCGACTGCAGAGGAGACACTTACTCCTCCAGATTCTCTGCAAGCCACC
CAGCATCTTGCCCGTGTTGTCAAGCTCGAGGGCAATAATCTCTTCACGTGCGAGTTGCCCGACAGTACTAGGCTC
GTCCTTGAACTTGCACAGCGTTTTCGAAACACAATATGGATCAAGCGTGGCGGCTTTGTCCTAGCTGAGTGCTAT
GAAGGCGCGCCATCAGGTGACTCTCGGGTTGAGGGCGAGATTGTCAATGTAGTGCGCGACGAGAAGCTATGGAGA
AAACAATCTTATTGGTGAGAAGCTATGCAGGCTGTCGGCATGGTCTGCCATGCGCCGCTGACAATTATATGTGGT
TTAGGCCCAAGGAGTTTGCAAAGTCTTCATATGAATTGAACCATGACCAAGACGAGTCCAATGTCGGCAAAATGC
CCCCTAGCGACTCAGAGGACGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail