Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1939
Gene name
LocationContig_163:20316..21582
Strand+
Gene length (bp)1266
Transcript length (bp)1266
Coding sequence length (bp)1266
Protein length (aa) 422

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04427 Brix Brix domain 4.0E-26 207 388

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38805|RPF1_YEAST Ribosome production factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF1 PE=1 SV=1 182 421 4.0E-68
sp|O14180|YDS4_SCHPO Brix domain-containing protein C4F8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F8.04 PE=3 SV=1 176 421 3.0E-52
sp|Q8AVP1|RPF1_XENLA Ribosome production factor 1 OS=Xenopus laevis GN=rpf1 PE=2 SV=1 149 421 6.0E-44
sp|Q9H9Y2|RPF1_HUMAN Ribosome production factor 1 OS=Homo sapiens GN=RPF1 PE=1 SV=2 149 421 1.0E-42
sp|Q5R631|RPF1_PONAB Ribosome production factor 1 OS=Pongo abelii GN=RPF1 PE=2 SV=1 149 421 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38805|RPF1_YEAST Ribosome production factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPF1 PE=1 SV=1 182 421 4.0E-68
sp|O14180|YDS4_SCHPO Brix domain-containing protein C4F8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F8.04 PE=3 SV=1 176 421 3.0E-52
sp|Q8AVP1|RPF1_XENLA Ribosome production factor 1 OS=Xenopus laevis GN=rpf1 PE=2 SV=1 149 421 6.0E-44
sp|Q9H9Y2|RPF1_HUMAN Ribosome production factor 1 OS=Homo sapiens GN=RPF1 PE=1 SV=2 149 421 1.0E-42
sp|Q5R631|RPF1_PONAB Ribosome production factor 1 OS=Pongo abelii GN=RPF1 PE=2 SV=1 149 421 1.0E-42
sp|Q7TND5|RPF1_MOUSE Ribosome production factor 1 OS=Mus musculus GN=Rpf1 PE=2 SV=2 149 421 2.0E-41
sp|Q6IQU6|RPF1_DANRE Ribosome production factor 1 OS=Danio rerio GN=rpf1 PE=2 SV=1 149 421 5.0E-41
sp|Q5RJS9|RPF1_RAT Ribosome production factor 1 OS=Rattus norvegicus GN=Rpf1 PE=2 SV=2 149 412 4.0E-40
sp|Q9VKB4|RPF1_DROME Probable ribosome production factor 1 OS=Drosophila melanogaster GN=CG6712 PE=2 SV=1 188 421 3.0E-37
sp|P54073|YUY1_CAEEL Brix domain-containing protein F44G4.1 OS=Caenorhabditis elegans GN=F44G4.1 PE=3 SV=4 190 421 2.0E-36
sp|Q6FNN7|IMP4_CANGA U3 small nucleolar ribonucleoprotein protein IMP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=IMP4 PE=3 SV=1 187 409 4.0E-22
sp|Q755T8|IMP4_ASHGO U3 small nucleolar ribonucleoprotein protein IMP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IMP4 PE=3 SV=2 187 409 9.0E-22
sp|O62518|YHPK_CAEEL Brix domain-containing protein ZK795.3 OS=Caenorhabditis elegans GN=ZK795.3 PE=3 SV=1 188 418 4.0E-21
sp|Q6C804|IMP4_YARLI U3 small nucleolar ribonucleoprotein protein IMP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IMP4 PE=3 SV=1 187 418 7.0E-21
sp|Q0VD01|IMP4_BOVIN U3 small nucleolar ribonucleoprotein protein IMP4 OS=Bos taurus GN=IMP4 PE=2 SV=1 188 421 6.0E-20
sp|Q5PQR5|IMP4_RAT U3 small nucleolar ribonucleoprotein protein IMP4 OS=Rattus norvegicus GN=Imp4 PE=2 SV=1 188 421 8.0E-20
sp|Q8VHZ7|IMP4_MOUSE U3 small nucleolar ribonucleoprotein protein IMP4 OS=Mus musculus GN=Imp4 PE=2 SV=1 188 421 8.0E-20
sp|Q5R947|IMP4_PONAB U3 small nucleolar ribonucleoprotein protein IMP4 OS=Pongo abelii GN=IMP4 PE=2 SV=2 188 421 9.0E-20
sp|Q96G21|IMP4_HUMAN U3 small nucleolar ribonucleoprotein protein IMP4 OS=Homo sapiens GN=IMP4 PE=1 SV=1 188 421 9.0E-20
sp|P53941|IMP4_YEAST U3 small nucleolar ribonucleoprotein protein IMP4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP4 PE=1 SV=1 188 409 5.0E-19
sp|Q6BYD9|IMP4_DEBHA U3 small nucleolar ribonucleoprotein protein IMP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IMP4 PE=3 SV=2 187 411 9.0E-19
sp|O13823|IMP4_SCHPO U3 small nucleolar ribonucleoprotein protein imp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp4 PE=3 SV=1 188 418 7.0E-18
[Show less]

GO

GO Term Description Terminal node
GO:0006364 rRNA processing Yes
GO:0019843 rRNA binding Yes
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0016072 rRNA metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0034660 ncRNA metabolic process No
GO:0034470 ncRNA processing No
GO:0009987 cellular process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0003674 molecular_function No
GO:0097159 organic cyclic compound binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0003723 RNA binding No
GO:0044237 cellular metabolic process No
GO:0016070 RNA metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3134
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1939 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2859
Ophiocordyceps camponoti-floridani Ophcf2|01905
Ophiocordyceps camponoti-rufipedis Ophun1|2441
Ophiocordyceps kimflemingae Ophio5|530
Ophiocordyceps subramaniannii Hirsu2|5506

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1939
MGFEKPSAQALQAANKMKRKELFGRHKKATGKERREERFRRRKEEQRDPALKTARLIKNKTVTLDQKRVWDEGND
DSLGARVDLEKLQRQRLEQAEAEEQSALEAEGKHRDKDDDDSMLGSDDDDSMLGSDDEDDDMSQACKDGYRRQQR
IQRDSSIAPSTASTNLDLAPLSLALKFPSLFSDIPPADSKILVTTSLNATIHDQAQLISTLFPNSTYVPRSGHRY
AYRYSLREICKFATKRNYTAVLLIKEDLKKPAGLSIVHLPSGPTCHFSITNYLEGKKLPGHGNPTNHYPELLLNN
FKTPLGLLTAKLFQSLFPPKPEIQGRQVVTMHNQRDYIFVRRHRYVFRDRRSSEKCIVDSEGREMKGVENIRVGL
QELGPQFTLKLRRVDKGIGRAGSEGEDATQWEWKAKMEKDRKRFNL*
Coding >OphauG2|1939
ATGGGTTTCGAAAAACCATCAGCACAGGCGCTTCAAGCGGCCAACAAGATGAAGCGAAAGGAACTTTTTGGCCGG
CACAAGAAGGCTACAGGGAAGGAGCGTCGAGAGGAGCGGTTCCGACGACGCAAAGAAGAACAACGCGATCCTGCG
CTCAAGACGGCCAGGTTAATTAAAAATAAGACGGTGACGCTTGACCAGAAGCGAGTATGGGATGAAGGCAACGAC
GACAGCCTGGGCGCCAGAGTCGACTTAGAGAAGCTACAGCGGCAGCGCTTGGAGCAGGCAGAGGCCGAGGAGCAG
TCGGCTCTCGAGGCGGAAGGGAAGCACCGGGATAAGGATGACGATGACAGCATGTTGGGCTCGGATGACGATGAC
AGCATGTTGGGCTCGGATGACGAGGATGACGACATGTCGCAAGCTTGCAAAGATGGGTATCGACGACAGCAACGC
ATTCAGAGAGATAGCAGTATCGCCCCATCAACAGCAAGCACCAACCTCGATCTTGCGCCTTTGTCGCTTGCTCTC
AAGTTCCCCTCGCTCTTCTCCGACATACCGCCTGCCGACTCTAAAATTCTCGTCACTACATCGCTCAACGCCACC
ATCCACGACCAGGCACAGCTCATATCGACCCTCTTTCCCAACAGCACATACGTCCCCCGCTCTGGACACCGTTAT
GCCTACCGCTATTCGCTCCGGGAAATTTGCAAATTTGCAACAAAGCGCAACTACACTGCCGTCCTCCTCATCAAA
GAGGACCTCAAGAAACCTGCTGGTCTCTCCATCGTCCATTTACCCTCGGGTCCAACCTGTCACTTTAGTATAACA
AATTACCTCGAGGGCAAAAAGCTTCCGGGCCACGGCAACCCAACGAACCACTATCCGGAGCTCCTACTCAACAAC
TTCAAGACACCTCTGGGATTACTCACCGCCAAACTCTTTCAGTCACTCTTCCCTCCAAAGCCCGAGATCCAGGGC
CGACAGGTCGTCACCATGCATAATCAGCGCGACTATATCTTTGTGCGCCGCCATCGCTACGTCTTTCGAGACAGG
CGTTCCTCCGAAAAGTGCATCGTAGACTCCGAGGGAAGGGAAATGAAGGGTGTCGAGAACATCCGCGTCGGACTA
CAAGAATTAGGACCTCAATTCACTCTGAAGTTGCGCAGAGTAGACAAAGGGATCGGACGAGCAGGTAGCGAGGGG
GAAGACGCCACTCAGTGGGAATGGAAGGCTAAAATGGAGAAAGATCGCAAACGGTTCAATTTATAA
Transcript >OphauG2|1939
ATGGGTTTCGAAAAACCATCAGCACAGGCGCTTCAAGCGGCCAACAAGATGAAGCGAAAGGAACTTTTTGGCCGG
CACAAGAAGGCTACAGGGAAGGAGCGTCGAGAGGAGCGGTTCCGACGACGCAAAGAAGAACAACGCGATCCTGCG
CTCAAGACGGCCAGGTTAATTAAAAATAAGACGGTGACGCTTGACCAGAAGCGAGTATGGGATGAAGGCAACGAC
GACAGCCTGGGCGCCAGAGTCGACTTAGAGAAGCTACAGCGGCAGCGCTTGGAGCAGGCAGAGGCCGAGGAGCAG
TCGGCTCTCGAGGCGGAAGGGAAGCACCGGGATAAGGATGACGATGACAGCATGTTGGGCTCGGATGACGATGAC
AGCATGTTGGGCTCGGATGACGAGGATGACGACATGTCGCAAGCTTGCAAAGATGGGTATCGACGACAGCAACGC
ATTCAGAGAGATAGCAGTATCGCCCCATCAACAGCAAGCACCAACCTCGATCTTGCGCCTTTGTCGCTTGCTCTC
AAGTTCCCCTCGCTCTTCTCCGACATACCGCCTGCCGACTCTAAAATTCTCGTCACTACATCGCTCAACGCCACC
ATCCACGACCAGGCACAGCTCATATCGACCCTCTTTCCCAACAGCACATACGTCCCCCGCTCTGGACACCGTTAT
GCCTACCGCTATTCGCTCCGGGAAATTTGCAAATTTGCAACAAAGCGCAACTACACTGCCGTCCTCCTCATCAAA
GAGGACCTCAAGAAACCTGCTGGTCTCTCCATCGTCCATTTACCCTCGGGTCCAACCTGTCACTTTAGTATAACA
AATTACCTCGAGGGCAAAAAGCTTCCGGGCCACGGCAACCCAACGAACCACTATCCGGAGCTCCTACTCAACAAC
TTCAAGACACCTCTGGGATTACTCACCGCCAAACTCTTTCAGTCACTCTTCCCTCCAAAGCCCGAGATCCAGGGC
CGACAGGTCGTCACCATGCATAATCAGCGCGACTATATCTTTGTGCGCCGCCATCGCTACGTCTTTCGAGACAGG
CGTTCCTCCGAAAAGTGCATCGTAGACTCCGAGGGAAGGGAAATGAAGGGTGTCGAGAACATCCGCGTCGGACTA
CAAGAATTAGGACCTCAATTCACTCTGAAGTTGCGCAGAGTAGACAAAGGGATCGGACGAGCAGGTAGCGAGGGG
GAAGACGCCACTCAGTGGGAATGGAAGGCTAAAATGGAGAAAGATCGCAAACGGTTCAATTTATAA
Gene >OphauG2|1939
ATGGGTTTCGAAAAACCATCAGCACAGGCGCTTCAAGCGGCCAACAAGATGAAGCGAAAGGAACTTTTTGGCCGG
CACAAGAAGGCTACAGGGAAGGAGCGTCGAGAGGAGCGGTTCCGACGACGCAAAGAAGAACAACGCGATCCTGCG
CTCAAGACGGCCAGGTTAATTAAAAATAAGACGGTGACGCTTGACCAGAAGCGAGTATGGGATGAAGGCAACGAC
GACAGCCTGGGCGCCAGAGTCGACTTAGAGAAGCTACAGCGGCAGCGCTTGGAGCAGGCAGAGGCCGAGGAGCAG
TCGGCTCTCGAGGCGGAAGGGAAGCACCGGGATAAGGATGACGATGACAGCATGTTGGGCTCGGATGACGATGAC
AGCATGTTGGGCTCGGATGACGAGGATGACGACATGTCGCAAGCTTGCAAAGATGGGTATCGACGACAGCAACGC
ATTCAGAGAGATAGCAGTATCGCCCCATCAACAGCAAGCACCAACCTCGATCTTGCGCCTTTGTCGCTTGCTCTC
AAGTTCCCCTCGCTCTTCTCCGACATACCGCCTGCCGACTCTAAAATTCTCGTCACTACATCGCTCAACGCCACC
ATCCACGACCAGGCACAGCTCATATCGACCCTCTTTCCCAACAGCACATACGTCCCCCGCTCTGGACACCGTTAT
GCCTACCGCTATTCGCTCCGGGAAATTTGCAAATTTGCAACAAAGCGCAACTACACTGCCGTCCTCCTCATCAAA
GAGGACCTCAAGAAACCTGCTGGTCTCTCCATCGTCCATTTACCCTCGGGTCCAACCTGTCACTTTAGTATAACA
AATTACCTCGAGGGCAAAAAGCTTCCGGGCCACGGCAACCCAACGAACCACTATCCGGAGCTCCTACTCAACAAC
TTCAAGACACCTCTGGGATTACTCACCGCCAAACTCTTTCAGTCACTCTTCCCTCCAAAGCCCGAGATCCAGGGC
CGACAGGTCGTCACCATGCATAATCAGCGCGACTATATCTTTGTGCGCCGCCATCGCTACGTCTTTCGAGACAGG
CGTTCCTCCGAAAAGTGCATCGTAGACTCCGAGGGAAGGGAAATGAAGGGTGTCGAGAACATCCGCGTCGGACTA
CAAGAATTAGGACCTCAATTCACTCTGAAGTTGCGCAGAGTAGACAAAGGGATCGGACGAGCAGGTAGCGAGGGG
GAAGACGCCACTCAGTGGGAATGGAAGGCTAAAATGGAGAAAGATCGCAAACGGTTCAATTTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail