Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1938
Gene name
LocationContig_163:17902..19939
Strand-
Gene length (bp)2037
Transcript length (bp)2037
Coding sequence length (bp)2037
Protein length (aa) 679

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07540 NOC3p Nucleolar complex-associated protein 7.4E-31 117 208
PF03914 CBF CBF/Mak21 family 3.4E-25 486 667

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q07896|NOC3_YEAST Nucleolar complex-associated protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC3 PE=1 SV=1 12 665 1.0E-92
sp|O94288|NOC3_SCHPO Nucleolar complex-associated protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=noc3 PE=1 SV=1 15 677 1.0E-80
sp|Q6DRN3|NOC3L_DANRE Nucleolar complex protein 3 homolog OS=Danio rerio GN=noc3l PE=2 SV=1 42 667 5.0E-66
sp|Q91Y26|NOC3L_CRIGR Nucleolar complex protein 3 homolog OS=Cricetulus griseus GN=NOC3L PE=2 SV=1 121 672 2.0E-53
sp|Q5R952|NOC3L_PONAB Nucleolar complex protein 3 homolog OS=Pongo abelii GN=NOC3L PE=2 SV=1 109 666 6.0E-53
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q07896|NOC3_YEAST Nucleolar complex-associated protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOC3 PE=1 SV=1 12 665 1.0E-92
sp|O94288|NOC3_SCHPO Nucleolar complex-associated protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=noc3 PE=1 SV=1 15 677 1.0E-80
sp|Q6DRN3|NOC3L_DANRE Nucleolar complex protein 3 homolog OS=Danio rerio GN=noc3l PE=2 SV=1 42 667 5.0E-66
sp|Q91Y26|NOC3L_CRIGR Nucleolar complex protein 3 homolog OS=Cricetulus griseus GN=NOC3L PE=2 SV=1 121 672 2.0E-53
sp|Q5R952|NOC3L_PONAB Nucleolar complex protein 3 homolog OS=Pongo abelii GN=NOC3L PE=2 SV=1 109 666 6.0E-53
sp|Q8VI84|NOC3L_MOUSE Nucleolar complex protein 3 homolog OS=Mus musculus GN=Noc3l PE=2 SV=2 121 666 1.0E-52
sp|Q8WTT2|NOC3L_HUMAN Nucleolar complex protein 3 homolog OS=Homo sapiens GN=NOC3L PE=1 SV=1 109 666 8.0E-52
sp|Q5XGZ8|NOC3L_XENLA Nucleolar complex protein 3 homolog OS=Xenopus laevis GN=noc3l PE=2 SV=1 44 666 2.0E-48
sp|Q9VI82|NOC3L_DROME Nucleolar complex protein 3 homolog OS=Drosophila melanogaster GN=CG1234 PE=1 SV=1 154 666 2.0E-31
sp|P91136|NOC3L_CAEEL Nucleolar complex protein 3 homolog OS=Caenorhabditis elegans GN=C37H5.5 PE=3 SV=3 132 651 1.0E-30
sp|Q61LN7|NOC3L_CAEBR Nucleolar complex protein 3 homolog OS=Caenorhabditis briggsae GN=CBG08826 PE=3 SV=1 85 651 1.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1938
MATNGTKRRKLAHHSSDDETFMSSKDSWKASYKNAARWNLEQDYESRPRKGRNNIKESTRLPQIKTANGRLEVLQ
TLEPDDDGRSEASDGEWLQEVQEEQPKQSPEPQIPEPQQIVQAQEELARLAMSVNENPEENVGALKTMAKFGWSK
VPTIQMLALMAQMAVFKDIIPGYRIRPQTEEATKDKLSKEVRCTRQYEQSLVSAYQTYVKSLARCAKLEAEPVNN
GQTLAGVAISCASSLLTAVPHFNFRTDLINILVGKLSSRRNDDYTAKCQQAFETLFRDDQEGRPSFESVSLLSKM
MKARKFQVDEGVVNLFLSLRLLNDFSGKASHQQVDHADGHQQATVGLKGKKNGREFRTKRERKERKEQKTLEKDM
AHADALVSHEERDRMQSETLKLVFATYFRILKLRCPHLMGAVLEGLAKYAHLINQDFFGDVLEALKDLIRYSDSD
ARDHDESPDTRIQPQHSHDDAEGPVGPMRNLTREALLCTVTAFALLAGQDAHNSRHHLHLDLSFFTTHLFRSILT
LSTSPDLENTLLKSSSKTTSVSASKVNVQTSTVLLLRSLTSILLPHYNVRQVAPLRLAAFAKQLMTVALQLPEKS
CQAVLGLLSDVAYTHGSKVRSLWNTEERKANGTFCPLSETAESSNPFAATVWEGELLRKHFSPKIRESVEILEKT
MSG*
Coding >OphauG2|1938
ATGGCAACAAATGGCACTAAACGAAGGAAACTGGCGCATCACTCGTCAGATGACGAGACCTTCATGTCGTCCAAA
GATTCGTGGAAAGCTTCCTATAAAAATGCCGCTAGATGGAACCTCGAACAAGACTACGAGTCGCGGCCTCGCAAA
GGAAGGAATAATATCAAGGAGAGCACTCGATTGCCACAGATCAAGACGGCAAATGGGCGCCTAGAGGTGTTACAG
ACTCTGGAACCAGATGATGATGGTCGGTCTGAGGCTAGTGATGGCGAGTGGCTTCAAGAGGTTCAAGAGGAACAG
CCAAAGCAGTCGCCAGAACCACAGATTCCAGAGCCGCAACAGATTGTGCAAGCGCAAGAGGAGCTTGCCCGGTTA
GCCATGTCGGTCAACGAGAATCCCGAAGAAAATGTTGGCGCGCTCAAGACCATGGCTAAATTTGGCTGGTCCAAG
GTGCCGACTATCCAAATGCTGGCTCTCATGGCACAGATGGCCGTTTTCAAGGACATAATTCCAGGATATCGCATA
CGCCCACAGACCGAGGAAGCGACAAAGGACAAACTGTCCAAAGAGGTGCGTTGTACAAGACAGTATGAACAGTCG
CTTGTGTCAGCATACCAGACGTATGTCAAGTCGCTGGCCCGGTGCGCCAAGCTTGAAGCAGAACCCGTCAATAAC
GGCCAGACCCTTGCCGGGGTGGCCATATCTTGCGCCTCTTCACTTTTGACGGCGGTACCGCACTTCAACTTCCGG
ACCGACCTGATAAATATTCTCGTGGGCAAGTTGAGCAGCAGACGAAATGATGACTACACAGCGAAATGTCAGCAG
GCTTTCGAGACGCTCTTTCGGGACGACCAAGAGGGACGACCGTCGTTCGAGTCAGTCTCTTTGCTCAGCAAGATG
ATGAAGGCCCGCAAATTTCAAGTCGACGAGGGTGTCGTCAATCTCTTTCTCAGCCTTCGCCTCCTCAACGACTTC
TCTGGCAAAGCCTCGCACCAACAAGTTGACCACGCCGACGGTCACCAGCAGGCAACTGTCGGGCTCAAAGGCAAG
AAAAATGGCCGCGAGTTCCGCACCAAGCGTGAACGCAAGGAGCGCAAGGAGCAAAAGACCTTGGAAAAGGACATG
GCCCATGCCGACGCCCTCGTCAGCCACGAGGAGCGCGATCGCATGCAGTCGGAAACGCTTAAGCTTGTCTTTGCT
ACGTACTTTCGTATTCTCAAGCTTCGCTGCCCGCACCTCATGGGCGCCGTGCTCGAGGGCCTGGCCAAGTATGCC
CACCTAATTAACCAGGACTTTTTTGGTGACGTTCTGGAGGCCCTCAAGGACTTGATTCGCTATAGCGATTCCGAC
GCTCGAGACCATGATGAGTCTCCCGATACGCGTATCCAGCCCCAACACTCACATGACGATGCTGAAGGCCCTGTC
GGTCCCATGCGCAACTTGACCCGCGAGGCGCTGCTCTGCACCGTTACCGCTTTTGCTCTGCTCGCTGGCCAAGAT
GCTCATAACTCGCGCCATCACTTGCATCTTGATCTCTCTTTTTTCACTACTCATCTCTTTCGCTCTATTCTCACA
CTCTCCACGAGTCCAGACCTTGAAAACACACTTCTCAAATCCTCCAGTAAGACTACCTCTGTTTCCGCTTCCAAA
GTCAACGTCCAGACCTCCACAGTCTTGCTCCTTCGTTCCCTCACCAGCATCCTCCTTCCCCACTACAATGTCCGC
CAAGTAGCACCTCTTCGTCTCGCTGCCTTTGCCAAGCAACTTATGACGGTTGCCCTCCAACTGCCAGAAAAGTCG
TGCCAGGCCGTCTTGGGCCTTCTCAGTGATGTGGCGTACACACACGGCTCAAAGGTTCGCAGTCTGTGGAACACT
GAGGAGCGCAAGGCCAACGGCACCTTTTGCCCGCTAAGCGAGACGGCTGAGAGCAGCAATCCTTTCGCAGCGACG
GTGTGGGAGGGAGAACTGCTGAGGAAGCATTTTTCACCAAAGATTCGCGAGAGTGTCGAGATACTGGAAAAGACC
ATGTCGGGCTAG
Transcript >OphauG2|1938
ATGGCAACAAATGGCACTAAACGAAGGAAACTGGCGCATCACTCGTCAGATGACGAGACCTTCATGTCGTCCAAA
GATTCGTGGAAAGCTTCCTATAAAAATGCCGCTAGATGGAACCTCGAACAAGACTACGAGTCGCGGCCTCGCAAA
GGAAGGAATAATATCAAGGAGAGCACTCGATTGCCACAGATCAAGACGGCAAATGGGCGCCTAGAGGTGTTACAG
ACTCTGGAACCAGATGATGATGGTCGGTCTGAGGCTAGTGATGGCGAGTGGCTTCAAGAGGTTCAAGAGGAACAG
CCAAAGCAGTCGCCAGAACCACAGATTCCAGAGCCGCAACAGATTGTGCAAGCGCAAGAGGAGCTTGCCCGGTTA
GCCATGTCGGTCAACGAGAATCCCGAAGAAAATGTTGGCGCGCTCAAGACCATGGCTAAATTTGGCTGGTCCAAG
GTGCCGACTATCCAAATGCTGGCTCTCATGGCACAGATGGCCGTTTTCAAGGACATAATTCCAGGATATCGCATA
CGCCCACAGACCGAGGAAGCGACAAAGGACAAACTGTCCAAAGAGGTGCGTTGTACAAGACAGTATGAACAGTCG
CTTGTGTCAGCATACCAGACGTATGTCAAGTCGCTGGCCCGGTGCGCCAAGCTTGAAGCAGAACCCGTCAATAAC
GGCCAGACCCTTGCCGGGGTGGCCATATCTTGCGCCTCTTCACTTTTGACGGCGGTACCGCACTTCAACTTCCGG
ACCGACCTGATAAATATTCTCGTGGGCAAGTTGAGCAGCAGACGAAATGATGACTACACAGCGAAATGTCAGCAG
GCTTTCGAGACGCTCTTTCGGGACGACCAAGAGGGACGACCGTCGTTCGAGTCAGTCTCTTTGCTCAGCAAGATG
ATGAAGGCCCGCAAATTTCAAGTCGACGAGGGTGTCGTCAATCTCTTTCTCAGCCTTCGCCTCCTCAACGACTTC
TCTGGCAAAGCCTCGCACCAACAAGTTGACCACGCCGACGGTCACCAGCAGGCAACTGTCGGGCTCAAAGGCAAG
AAAAATGGCCGCGAGTTCCGCACCAAGCGTGAACGCAAGGAGCGCAAGGAGCAAAAGACCTTGGAAAAGGACATG
GCCCATGCCGACGCCCTCGTCAGCCACGAGGAGCGCGATCGCATGCAGTCGGAAACGCTTAAGCTTGTCTTTGCT
ACGTACTTTCGTATTCTCAAGCTTCGCTGCCCGCACCTCATGGGCGCCGTGCTCGAGGGCCTGGCCAAGTATGCC
CACCTAATTAACCAGGACTTTTTTGGTGACGTTCTGGAGGCCCTCAAGGACTTGATTCGCTATAGCGATTCCGAC
GCTCGAGACCATGATGAGTCTCCCGATACGCGTATCCAGCCCCAACACTCACATGACGATGCTGAAGGCCCTGTC
GGTCCCATGCGCAACTTGACCCGCGAGGCGCTGCTCTGCACCGTTACCGCTTTTGCTCTGCTCGCTGGCCAAGAT
GCTCATAACTCGCGCCATCACTTGCATCTTGATCTCTCTTTTTTCACTACTCATCTCTTTCGCTCTATTCTCACA
CTCTCCACGAGTCCAGACCTTGAAAACACACTTCTCAAATCCTCCAGTAAGACTACCTCTGTTTCCGCTTCCAAA
GTCAACGTCCAGACCTCCACAGTCTTGCTCCTTCGTTCCCTCACCAGCATCCTCCTTCCCCACTACAATGTCCGC
CAAGTAGCACCTCTTCGTCTCGCTGCCTTTGCCAAGCAACTTATGACGGTTGCCCTCCAACTGCCAGAAAAGTCG
TGCCAGGCCGTCTTGGGCCTTCTCAGTGATGTGGCGTACACACACGGCTCAAAGGTTCGCAGTCTGTGGAACACT
GAGGAGCGCAAGGCCAACGGCACCTTTTGCCCGCTAAGCGAGACGGCTGAGAGCAGCAATCCTTTCGCAGCGACG
GTGTGGGAGGGAGAACTGCTGAGGAAGCATTTTTCACCAAAGATTCGCGAGAGTGTCGAGATACTGGAAAAGACC
ATGTCGGGCTAG
Gene >OphauG2|1938
ATGGCAACAAATGGCACTAAACGAAGGAAACTGGCGCATCACTCGTCAGATGACGAGACCTTCATGTCGTCCAAA
GATTCGTGGAAAGCTTCCTATAAAAATGCCGCTAGATGGAACCTCGAACAAGACTACGAGTCGCGGCCTCGCAAA
GGAAGGAATAATATCAAGGAGAGCACTCGATTGCCACAGATCAAGACGGCAAATGGGCGCCTAGAGGTGTTACAG
ACTCTGGAACCAGATGATGATGGTCGGTCTGAGGCTAGTGATGGCGAGTGGCTTCAAGAGGTTCAAGAGGAACAG
CCAAAGCAGTCGCCAGAACCACAGATTCCAGAGCCGCAACAGATTGTGCAAGCGCAAGAGGAGCTTGCCCGGTTA
GCCATGTCGGTCAACGAGAATCCCGAAGAAAATGTTGGCGCGCTCAAGACCATGGCTAAATTTGGCTGGTCCAAG
GTGCCGACTATCCAAATGCTGGCTCTCATGGCACAGATGGCCGTTTTCAAGGACATAATTCCAGGATATCGCATA
CGCCCACAGACCGAGGAAGCGACAAAGGACAAACTGTCCAAAGAGGTGCGTTGTACAAGACAGTATGAACAGTCG
CTTGTGTCAGCATACCAGACGTATGTCAAGTCGCTGGCCCGGTGCGCCAAGCTTGAAGCAGAACCCGTCAATAAC
GGCCAGACCCTTGCCGGGGTGGCCATATCTTGCGCCTCTTCACTTTTGACGGCGGTACCGCACTTCAACTTCCGG
ACCGACCTGATAAATATTCTCGTGGGCAAGTTGAGCAGCAGACGAAATGATGACTACACAGCGAAATGTCAGCAG
GCTTTCGAGACGCTCTTTCGGGACGACCAAGAGGGACGACCGTCGTTCGAGTCAGTCTCTTTGCTCAGCAAGATG
ATGAAGGCCCGCAAATTTCAAGTCGACGAGGGTGTCGTCAATCTCTTTCTCAGCCTTCGCCTCCTCAACGACTTC
TCTGGCAAAGCCTCGCACCAACAAGTTGACCACGCCGACGGTCACCAGCAGGCAACTGTCGGGCTCAAAGGCAAG
AAAAATGGCCGCGAGTTCCGCACCAAGCGTGAACGCAAGGAGCGCAAGGAGCAAAAGACCTTGGAAAAGGACATG
GCCCATGCCGACGCCCTCGTCAGCCACGAGGAGCGCGATCGCATGCAGTCGGAAACGCTTAAGCTTGTCTTTGCT
ACGTACTTTCGTATTCTCAAGCTTCGCTGCCCGCACCTCATGGGCGCCGTGCTCGAGGGCCTGGCCAAGTATGCC
CACCTAATTAACCAGGACTTTTTTGGTGACGTTCTGGAGGCCCTCAAGGACTTGATTCGCTATAGCGATTCCGAC
GCTCGAGACCATGATGAGTCTCCCGATACGCGTATCCAGCCCCAACACTCACATGACGATGCTGAAGGCCCTGTC
GGTCCCATGCGCAACTTGACCCGCGAGGCGCTGCTCTGCACCGTTACCGCTTTTGCTCTGCTCGCTGGCCAAGAT
GCTCATAACTCGCGCCATCACTTGCATCTTGATCTCTCTTTTTTCACTACTCATCTCTTTCGCTCTATTCTCACA
CTCTCCACGAGTCCAGACCTTGAAAACACACTTCTCAAATCCTCCAGTAAGACTACCTCTGTTTCCGCTTCCAAA
GTCAACGTCCAGACCTCCACAGTCTTGCTCCTTCGTTCCCTCACCAGCATCCTCCTTCCCCACTACAATGTCCGC
CAAGTAGCACCTCTTCGTCTCGCTGCCTTTGCCAAGCAACTTATGACGGTTGCCCTCCAACTGCCAGAAAAGTCG
TGCCAGGCCGTCTTGGGCCTTCTCAGTGATGTGGCGTACACACACGGCTCAAAGGTTCGCAGTCTGTGGAACACT
GAGGAGCGCAAGGCCAACGGCACCTTTTGCCCGCTAAGCGAGACGGCTGAGAGCAGCAATCCTTTCGCAGCGACG
GTGTGGGAGGGAGAACTGCTGAGGAAGCATTTTTCACCAAAGATTCGCGAGAGTGTCGAGATACTGGAAAAGACC
ATGTCGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail