Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1928
Gene name
LocationContig_1624:548..2368
Strand+
Gene length (bp)1820
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 1.4E-31 24 123
PF00085 Thioredoxin Thioredoxin 1.7E-27 358 463
PF13848 Thioredoxin_6 Thioredoxin-like domain 1.3E-06 57 162
PF13848 Thioredoxin_6 Thioredoxin-like domain 5.2E-38 158 335
PF01216 Calsequestrin Calsequestrin 6.2E-08 62 206

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 22 472 0.0E+00
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 10 511 0.0E+00
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 10 498 0.0E+00
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 22 489 0.0E+00
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 1 498 4.0E-140
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P55059|PDI_HUMIN Protein disulfide-isomerase OS=Humicola insolens PE=1 SV=1 22 472 0.0E+00
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 10 511 0.0E+00
sp|Q12730|PDI_ASPNG Protein disulfide-isomerase OS=Aspergillus niger GN=pdiA PE=2 SV=1 10 498 0.0E+00
sp|Q00248|PDI_ASPOR Protein disulfide-isomerase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pdiA PE=3 SV=1 22 489 0.0E+00
sp|Q10057|PDI1_SCHPO Putative protein disulfide-isomerase C1F5.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.02 PE=3 SV=1 1 498 4.0E-140
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 123 438 2.0E-134
sp|P17967|PDI_YEAST Protein disulfide-isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDI1 PE=1 SV=2 16 467 1.0E-108
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 21 498 4.0E-100
sp|Q17770|PDI2_CAEEL Protein disulfide-isomerase 2 OS=Caenorhabditis elegans GN=pdi-2 PE=1 SV=1 6 466 2.0E-92
sp|Q5R5B6|PDIA1_PONAB Protein disulfide-isomerase OS=Pongo abelii GN=P4HB PE=2 SV=1 10 466 1.0E-91
sp|P07237|PDIA1_HUMAN Protein disulfide-isomerase OS=Homo sapiens GN=P4HB PE=1 SV=3 21 466 9.0E-90
sp|P05307|PDIA1_BOVIN Protein disulfide-isomerase OS=Bos taurus GN=P4HB PE=1 SV=1 13 466 3.0E-89
sp|P21195|PDIA1_RABIT Protein disulfide-isomerase OS=Oryctolagus cuniculus GN=P4HB PE=2 SV=1 6 466 7.0E-89
sp|Q2HWU2|PDIA1_MACFU Protein disulfide-isomerase OS=Macaca fuscata fuscata GN=P4HB PE=2 SV=1 21 466 2.0E-88
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 21 498 1.0E-84
sp|P04785|PDIA1_RAT Protein disulfide-isomerase OS=Rattus norvegicus GN=P4hb PE=1 SV=2 21 498 1.0E-84
sp|Q8R4U2|PDIA1_CRIGR Protein disulfide-isomerase OS=Cricetulus griseus GN=P4HB PE=2 SV=1 10 498 2.0E-84
sp|P09102|PDIA1_CHICK Protein disulfide-isomerase OS=Gallus gallus GN=P4HB PE=1 SV=3 10 466 5.0E-83
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 24 465 1.0E-82
sp|P54399|PDI_DROME Protein disulfide-isomerase OS=Drosophila melanogaster GN=Pdi PE=2 SV=1 31 466 2.0E-82
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 10 461 4.0E-81
sp|P12244|GSBP_CHICK Dolichyl-diphosphooligosaccharide--protein glycotransferase OS=Gallus gallus PE=2 SV=2 11 498 8.0E-79
sp|Q43116|PDI_RICCO Protein disulfide-isomerase OS=Ricinus communis PE=2 SV=1 6 464 1.0E-78
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 20 464 7.0E-78
sp|P32474|EUG1_YEAST Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EUG1 PE=1 SV=1 18 467 1.0E-77
sp|P27773|PDIA3_MOUSE Protein disulfide-isomerase A3 OS=Mus musculus GN=Pdia3 PE=1 SV=2 6 462 1.0E-77
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 22 463 1.0E-76
sp|Q8JG64|PDIA3_CHICK Protein disulfide-isomerase A3 OS=Gallus gallus GN=PDIA3 PE=2 SV=1 41 462 1.0E-76
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 22 462 2.0E-76
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 22 462 2.0E-76
sp|P38657|PDIA3_BOVIN Protein disulfide-isomerase A3 OS=Bos taurus GN=PDIA3 PE=2 SV=1 22 462 3.0E-76
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 27 465 5.0E-76
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 27 465 7.0E-76
sp|P11598|PDIA3_RAT Protein disulfide-isomerase A3 OS=Rattus norvegicus GN=Pdia3 PE=1 SV=2 6 463 1.0E-75
sp|Q9SRG3|PDI12_ARATH Protein disulfide isomerase-like 1-2 OS=Arabidopsis thaliana GN=PDIL1-2 PE=2 SV=1 24 487 1.0E-75
sp|Q9XF61|PDI_DATGL Protein disulfide-isomerase OS=Datisca glomerata GN=PDI PE=2 SV=1 24 464 1.0E-75
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 27 504 3.0E-75
sp|Q8VX13|PDI13_ARATH Protein disulfide isomerase-like 1-3 OS=Arabidopsis thaliana GN=PDIL1-3 PE=2 SV=1 24 502 2.0E-74
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 24 464 2.0E-74
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 27 465 9.0E-74
sp|Q9XI01|PDI11_ARATH Protein disulfide isomerase-like 1-1 OS=Arabidopsis thaliana GN=PDIL1-1 PE=1 SV=1 24 464 3.0E-73
sp|Q69ST6|PID13_ORYSJ Protein disulfide isomerase-like 1-3 OS=Oryza sativa subsp. japonica GN=PDIL1-3 PE=2 SV=1 24 480 2.0E-72
sp|Q7XRB5|PDI12_ORYSJ Protein disulfide isomerase-like 1-2 OS=Oryza sativa subsp. japonica GN=PDIL1-2 PE=2 SV=2 24 469 1.0E-70
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 24 484 4.0E-70
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 24 464 1.0E-69
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 465 1.0E-69
sp|Q67IX6|PDI14_ORYSJ Protein disulfide isomerase-like 1-4 OS=Oryza sativa subsp. japonica GN=PDIL1-4 PE=2 SV=1 21 465 2.0E-69
sp|P52588|PDI_MAIZE Protein disulfide-isomerase OS=Zea mays GN=PDI PE=2 SV=1 24 464 2.0E-68
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 42 465 9.0E-65
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 27 484 2.0E-63
sp|Q17967|PDI1_CAEEL Protein disulfide-isomerase 1 OS=Caenorhabditis elegans GN=pdi-1 PE=3 SV=1 8 480 5.0E-63
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 27 470 6.0E-63
sp|P12865|BS2_TRYBB Bloodstream-specific protein 2 OS=Trypanosoma brucei brucei GN=BS2 PE=3 SV=1 5 464 8.0E-63
sp|Q66GQ3|PDI16_ARATH Protein disulfide isomerase-like 1-6 OS=Arabidopsis thaliana GN=PDIL1-6 PE=2 SV=1 17 468 2.0E-40
sp|A3KPF5|PDI15_ARATH Protein disulfide isomerase-like 1-5 OS=Arabidopsis thaliana GN=PDIL1-5 PE=2 SV=1 17 471 3.0E-39
sp|Q5WA72|PDI15_ORYSJ Protein disulfide isomerase-like 1-5 OS=Oryza sativa subsp. japonica GN=PDIL1-5 PE=2 SV=1 17 463 3.0E-39
sp|Q9DAN1|PDILT_MOUSE Protein disulfide-isomerase-like protein of the testis OS=Mus musculus GN=Pdilt PE=1 SV=2 21 470 7.0E-26
sp|Q8N807|PDILT_HUMAN Protein disulfide-isomerase-like protein of the testis OS=Homo sapiens GN=PDILT PE=1 SV=2 24 470 2.0E-24
sp|Q5XI02|PDILT_RAT Protein disulfide-isomerase-like protein of the testis OS=Rattus norvegicus GN=Pdilt PE=1 SV=1 21 470 7.0E-24
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 317 463 3.0E-23
sp|Q95LM0|PDILT_MACFA Protein disulfide-isomerase-like protein of the testis OS=Macaca fascicularis GN=PDILT PE=2 SV=1 32 461 3.0E-23
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 325 494 3.0E-23
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 357 486 9.0E-23
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 24 127 3.0E-22
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 358 463 6.0E-22
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 1 153 2.0E-21
sp|Q3T0L2|ERP44_BOVIN Endoplasmic reticulum resident protein 44 OS=Bos taurus GN=ERP44 PE=2 SV=1 6 351 3.0E-21
sp|Q9BS26|ERP44_HUMAN Endoplasmic reticulum resident protein 44 OS=Homo sapiens GN=ERP44 PE=1 SV=1 6 351 4.0E-21
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 24 127 6.0E-21
sp|Q9D1Q6|ERP44_MOUSE Endoplasmic reticulum resident protein 44 OS=Mus musculus GN=Erp44 PE=1 SV=1 10 351 8.0E-21
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 21 340 9.0E-21
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 24 133 1.0E-20
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 361 470 1.0E-20
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 358 463 2.0E-20
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 6 123 5.0E-20
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 24 135 2.0E-19
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 27 133 2.0E-19
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 5 139 2.0E-19
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 19 224 3.0E-19
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 21 340 5.0E-19
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 365 469 5.0E-19
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 24 222 6.0E-19
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 261 463 6.0E-19
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 24 153 8.0E-19
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 27 153 8.0E-19
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 16 211 1.0E-18
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 24 153 2.0E-18
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 31 155 2.0E-18
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 26 227 3.0E-18
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 355 471 5.0E-18
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 16 463 9.0E-18
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 24 153 1.0E-17
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 27 135 1.0E-17
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 24 126 1.0E-17
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 356 500 1.0E-17
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 5 139 1.0E-17
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 10 178 2.0E-17
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 26 122 2.0E-17
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 17 173 3.0E-17
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 5 139 3.0E-17
sp|Q9FF55|PDI14_ARATH Protein disulfide isomerase-like 1-4 OS=Arabidopsis thaliana GN=PDIL1-4 PE=1 SV=1 349 462 5.0E-17
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 6 139 6.0E-17
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 349 479 1.0E-16
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 375 463 1.0E-16
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 6 139 2.0E-16
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 6 132 2.0E-16
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 6 339 3.0E-16
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 17 117 5.0E-16
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 6 126 5.0E-16
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 19 342 5.0E-16
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 27 102 6.0E-16
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 17 127 7.0E-16
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 7 226 8.0E-16
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 376 463 9.0E-16
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 16 463 1.0E-15
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 358 463 2.0E-15
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 16 463 2.0E-15
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 358 463 3.0E-15
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 16 463 3.0E-15
sp|P08003|PDIA4_MOUSE Protein disulfide-isomerase A4 OS=Mus musculus GN=Pdia4 PE=1 SV=3 349 479 4.0E-15
sp|P13667|PDIA4_HUMAN Protein disulfide-isomerase A4 OS=Homo sapiens GN=PDIA4 PE=1 SV=2 358 463 4.0E-15
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 259 465 4.0E-15
sp|P38661|PDIA6_MEDSA Probable protein disulfide-isomerase A6 OS=Medicago sativa PE=2 SV=1 365 472 5.0E-15
sp|P38659|PDIA4_RAT Protein disulfide-isomerase A4 OS=Rattus norvegicus GN=Pdia4 PE=1 SV=2 349 464 7.0E-15
sp|Q69SA9|PDI54_ORYSJ Protein disulfide isomerase-like 5-4 OS=Oryza sativa subsp. japonica GN=PDIL5-4 PE=2 SV=1 27 102 9.0E-15
sp|Q29RV1|PDIA4_BOVIN Protein disulfide-isomerase A4 OS=Bos taurus GN=PDIA4 PE=2 SV=1 358 463 1.0E-14
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 365 458 2.0E-14
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 24 236 2.0E-14
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 365 458 2.0E-14
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 24 121 2.0E-14
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 370 458 3.0E-14
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 370 458 3.0E-14
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 19 125 4.0E-14
sp|O22263|PDI21_ARATH Protein disulfide-isomerase like 2-1 OS=Arabidopsis thaliana GN=PDIL2-1 PE=2 SV=1 375 465 4.0E-14
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 19 125 4.0E-14
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 370 458 4.0E-14
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 17 117 5.0E-14
sp|Q942L2|PDI22_ORYSJ Protein disulfide isomerase-like 2-2 OS=Oryza sativa subsp. japonica GN=PDIL2-2 PE=2 SV=1 358 465 6.0E-14
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 16 121 6.0E-14
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 357 460 6.0E-14
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 305 466 7.0E-14
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 14 126 7.0E-14
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 16 121 7.0E-14
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 16 121 7.0E-14
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 365 460 7.0E-14
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 378 472 8.0E-14
sp|P09103|PDIA1_MOUSE Protein disulfide-isomerase OS=Mus musculus GN=P4hb PE=1 SV=2 354 462 1.0E-13
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 22 154 1.0E-13
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 7 202 1.0E-13
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 342 492 2.0E-13
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 357 460 2.0E-13
sp|O48773|PDI23_ARATH Protein disulfide-isomerase 2-3 OS=Arabidopsis thaliana GN=PDIL2-3 PE=2 SV=1 244 463 2.0E-13
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 16 139 3.0E-13
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 20 102 5.0E-13
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 29 439 9.0E-13
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 41 202 1.0E-12
sp|Q13087|PDIA2_HUMAN Protein disulfide-isomerase A2 OS=Homo sapiens GN=PDIA2 PE=1 SV=2 360 481 2.0E-12
sp|Q5RCH2|PDIA2_PONAB Protein disulfide-isomerase A2 OS=Pongo abelii GN=PDIA2 PE=2 SV=1 360 481 2.0E-12
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 1 155 2.0E-12
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 38 342 2.0E-12
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 1 155 3.0E-12
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 1 147 3.0E-12
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 358 460 4.0E-12
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 194 489 4.0E-12
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 1 147 4.0E-12
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 38 342 4.0E-12
sp|D3Z6P0|PDIA2_MOUSE Protein disulfide-isomerase A2 OS=Mus musculus GN=Pdia2 PE=1 SV=1 342 464 5.0E-12
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 365 480 5.0E-12
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 343 466 8.0E-12
sp|Q50KB1|SEP2_EMIHU Protein disulfide-isomerase-like protein EhSep2 OS=Emiliania huxleyi GN=SEP2 PE=1 SV=2 26 133 8.0E-12
sp|Q11067|PDIA6_CAEEL Probable protein disulfide-isomerase A6 OS=Caenorhabditis elegans GN=tag-320 PE=3 SV=1 365 457 2.0E-11
sp|Q17688|TXNDL_CAEEL Thioredoxin domain-containing protein C06A6.5 OS=Caenorhabditis elegans GN=C06A6.5 PE=1 SV=2 26 342 2.0E-11
sp|Q9RD25|THIO2_STRCO Putative thioredoxin-2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxC PE=2 SV=1 26 102 3.0E-11
sp|Q4VIT4|PDIA3_CHLAE Protein disulfide-isomerase A3 OS=Chlorocebus aethiops GN=PDIA3 PE=2 SV=1 19 127 4.0E-11
sp|Q5RDG4|PDIA3_PONAB Protein disulfide-isomerase A3 OS=Pongo abelii GN=PDIA3 PE=2 SV=1 19 127 4.0E-11
sp|P30101|PDIA3_HUMAN Protein disulfide-isomerase A3 OS=Homo sapiens GN=PDIA3 PE=1 SV=4 19 127 4.0E-11
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 22 127 4.0E-11
sp|P34329|PDIA4_CAEEL Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans GN=C14B9.2 PE=3 SV=2 352 461 5.0E-11
sp|Q6PKC3|TXD11_HUMAN Thioredoxin domain-containing protein 11 OS=Homo sapiens GN=TXNDC11 PE=1 SV=2 278 461 7.0E-11
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 21 122 8.0E-11
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 342 484 9.0E-11
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 26 107 9.0E-11
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 24 116 1.0E-10
sp|P38660|PDIA6_MESAU Protein disulfide-isomerase A6 OS=Mesocricetus auratus GN=PDIA6 PE=1 SV=1 358 458 2.0E-10
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 32 112 2.0E-10
sp|Q9LJU2|PDI53_ARATH Protein disulfide-isomerase 5-3 OS=Arabidopsis thaliana GN=PDIL5-3 PE=2 SV=1 27 148 2.0E-10
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 24 103 2.0E-10
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 24 116 3.0E-10
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 22 107 3.0E-10
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 22 107 3.0E-10
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 363 489 4.0E-10
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 24 123 4.0E-10
sp|A4FUW8|TXD11_BOVIN Thioredoxin domain-containing protein 11 OS=Bos taurus GN=TXNDC11 PE=2 SV=1 251 461 4.0E-10
sp|Q63081|PDIA6_RAT Protein disulfide-isomerase A6 OS=Rattus norvegicus GN=Pdia6 PE=1 SV=2 358 458 5.0E-10
sp|Q8GYD1|PDI51_ARATH Protein disulfide-isomerase 5-1 OS=Arabidopsis thaliana GN=PDIL5-1 PE=2 SV=1 17 141 5.0E-10
sp|P14949|THIO_BACSU Thioredoxin OS=Bacillus subtilis (strain 168) GN=trxA PE=1 SV=3 37 126 6.0E-10
sp|Q15084|PDIA6_HUMAN Protein disulfide-isomerase A6 OS=Homo sapiens GN=PDIA6 PE=1 SV=1 358 458 7.0E-10
sp|Q5R6T1|PDIA6_PONAB Protein disulfide-isomerase A6 OS=Pongo abelii GN=PDIA6 PE=2 SV=1 358 458 7.0E-10
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 59 437 7.0E-10
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 24 103 7.0E-10
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 252 462 8.0E-10
sp|P22217|TRX1_YEAST Thioredoxin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX1 PE=1 SV=3 23 116 9.0E-10
sp|Q922R8|PDIA6_MOUSE Protein disulfide-isomerase A6 OS=Mus musculus GN=Pdia6 PE=1 SV=3 358 458 1.0E-09
sp|Q91W90|TXND5_MOUSE Thioredoxin domain-containing protein 5 OS=Mus musculus GN=Txndc5 PE=1 SV=2 378 461 2.0E-09
sp|Q8NBS9|TXND5_HUMAN Thioredoxin domain-containing protein 5 OS=Homo sapiens GN=TXNDC5 PE=1 SV=2 378 461 2.0E-09
sp|Q0E0I1|PDI53_ORYSJ Protein disulfide isomerase-like 5-3 OS=Oryza sativa subsp. japonica GN=PDIL5-3 PE=3 SV=1 377 463 2.0E-09
sp|Q0JD42|PDI52_ORYSJ Protein disulfide isomerase-like 5-2 OS=Oryza sativa subsp. japonica GN=PDIL5-2 PE=2 SV=2 377 459 2.0E-09
sp|Q6GNG3|TMX3_XENLA Protein disulfide-isomerase TMX3 OS=Xenopus laevis GN=tmx3 PE=2 SV=1 357 460 2.0E-09
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 24 123 2.0E-09
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 24 111 2.0E-09
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 31 105 2.0E-09
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 278 461 2.0E-09
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 33 102 2.0E-09
sp|Q10N04|PDI51_ORYSJ Protein disulfide isomerase-like 5-1 OS=Oryza sativa subsp. japonica GN=PDIL5-1 PE=2 SV=1 22 123 2.0E-09
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 22 107 2.0E-09
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 365 440 3.0E-09
sp|O13811|PDI2_SCHPO Protein disulfide-isomerase C17H9.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.14c PE=3 SV=1 43 127 4.0E-09
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 24 123 4.0E-09
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 13 102 4.0E-09
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 46 101 5.0E-09
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 46 101 5.0E-09
sp|Q8K2W3|TXD11_MOUSE Thioredoxin domain-containing protein 11 OS=Mus musculus GN=Txndc11 PE=1 SV=1 39 204 6.0E-09
sp|Q9R6P9|THIO_MYCGA Thioredoxin OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=trxA PE=3 SV=2 25 102 6.0E-09
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 358 446 6.0E-09
sp|P50254|THIO_PYRYE Thioredoxin OS=Pyropia yezoensis GN=trxA PE=3 SV=1 24 125 6.0E-09
sp|Q9T042|PDI54_ARATH Protein disulfide-isomerase 5-4 OS=Arabidopsis thaliana GN=PDIL5-4 PE=2 SV=1 377 499 7.0E-09
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 378 480 7.0E-09
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 46 117 7.0E-09
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 364 453 7.0E-09
sp|Q94F09|PDI52_ARATH Protein disulfide-isomerase 5-2 OS=Arabidopsis thaliana GN=PDIL5-2 PE=1 SV=1 377 463 1.0E-08
sp|Q8BXZ1|TMX3_MOUSE Protein disulfide-isomerase TMX3 OS=Mus musculus GN=Tmx3 PE=1 SV=2 372 460 1.0E-08
sp|Q96JJ7|TMX3_HUMAN Protein disulfide-isomerase TMX3 OS=Homo sapiens GN=TMX3 PE=1 SV=2 378 460 1.0E-08
sp|O08841|QSOX1_CAVPO Sulfhydryl oxidase 1 OS=Cavia porcellus GN=QSOX1 PE=2 SV=2 357 444 1.0E-08
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 24 112 1.0E-08
sp|P33791|THIO_STRAU Thioredoxin (Fragment) OS=Streptomyces aureofaciens GN=trxA PE=3 SV=1 34 103 1.0E-08
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 34 102 1.0E-08
sp|A4FUW8|TXD11_BOVIN Thioredoxin domain-containing protein 11 OS=Bos taurus GN=TXNDC11 PE=2 SV=1 39 204 2.0E-08
sp|P52232|THIO1_SYNY3 Thioredoxin-like protein slr0233 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0233 PE=1 SV=1 29 102 2.0E-08
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 34 123 2.0E-08
sp|Q9ZP21|TRXM_WHEAT Thioredoxin M-type, chloroplastic OS=Triticum aestivum PE=2 SV=1 358 453 2.0E-08
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 23 116 2.0E-08
sp|P0AGG7|THIO2_SHIFL Thioredoxin-2 OS=Shigella flexneri GN=trxC PE=3 SV=1 21 112 2.0E-08
sp|P0AGG4|THIO2_ECOLI Thioredoxin-2 OS=Escherichia coli (strain K12) GN=trxC PE=1 SV=1 21 112 2.0E-08
sp|P0AGG5|THIO2_ECOL6 Thioredoxin-2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxC PE=3 SV=1 21 112 2.0E-08
sp|P0AGG6|THIO2_ECO57 Thioredoxin-2 OS=Escherichia coli O157:H7 GN=trxC PE=3 SV=1 21 112 2.0E-08
sp|Q498R3|DJC10_RAT DnaJ homolog subfamily C member 10 OS=Rattus norvegicus GN=Dnajc10 PE=2 SV=2 46 101 3.0E-08
sp|Q4N4N8|TXND_THEPA Thioredoxin domain-containing protein OS=Theileria parva GN=TP02_0602 PE=1 SV=1 378 460 3.0E-08
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 252 462 3.0E-08
sp|Q6XHI1|THIO2_DROYA Thioredoxin-2 OS=Drosophila yakuba GN=Trx-2 PE=3 SV=1 374 459 3.0E-08
sp|Q9X2T1|THIO_PSEAE Thioredoxin OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=trxA PE=3 SV=1 23 102 3.0E-08
sp|Q9DC23|DJC10_MOUSE DnaJ homolog subfamily C member 10 OS=Mus musculus GN=Dnajc10 PE=1 SV=2 46 102 4.0E-08
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 252 462 4.0E-08
sp|P46843|TRXB_MYCLE Bifunctional thioredoxin reductase/thioredoxin OS=Mycobacterium leprae (strain TN) GN=trxB/A PE=3 SV=1 32 119 4.0E-08
sp|P51225|THIO_PORPU Thioredoxin OS=Porphyra purpurea GN=trxA PE=3 SV=1 24 125 4.0E-08
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 367 441 5.0E-08
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 372 459 5.0E-08
sp|P9WG67|THIO_MYCTU Thioredoxin OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=trxA PE=1 SV=1 34 102 5.0E-08
sp|P9WG66|THIO_MYCTO Thioredoxin OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=trxA PE=3 SV=1 34 102 5.0E-08
sp|P0A617|THIO_MYCBO Thioredoxin OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=trxA PE=3 SV=2 34 102 5.0E-08
sp|P42115|THIO_NEUCR Thioredoxin OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=trx PE=3 SV=1 25 108 5.0E-08
sp|Q5R875|TMX3_PONAB Protein disulfide-isomerase TMX3 OS=Pongo abelii GN=TMX3 PE=2 SV=1 378 460 6.0E-08
sp|P23400|TRXM_CHLRE Thioredoxin M-type, chloroplastic OS=Chlamydomonas reinhardtii GN=TRXM PE=1 SV=3 365 442 6.0E-08
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 368 440 6.0E-08
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 364 440 7.0E-08
sp|Q69AB1|TXND8_RAT Thioredoxin domain-containing protein 8 OS=Rattus norvegicus GN=Txndc8 PE=2 SV=1 28 111 7.0E-08
sp|Q9V429|THIO2_DROME Thioredoxin-2 OS=Drosophila melanogaster GN=Trx-2 PE=1 SV=2 374 459 8.0E-08
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 34 103 8.0E-08
sp|Q5JMR9|TRXY_ORYSJ Thioredoxin Y, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0963400 PE=3 SV=2 6 119 8.0E-08
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 34 102 8.0E-08
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 252 462 1.0E-07
sp|Q8L7S9|TRXY2_ARATH Thioredoxin Y2, chloroplastic OS=Arabidopsis thaliana GN=At1g43560 PE=2 SV=1 31 126 1.0E-07
sp|Q8S091|TRXF_ORYSJ Thioredoxin F, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0913000 PE=2 SV=1 11 122 1.0E-07
sp|O51890|THIO_BUCAP Thioredoxin OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=trxA PE=3 SV=1 364 466 1.0E-07
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 30 103 1.0E-07
sp|Q9PJK3|THIO_CHLMU Thioredoxin OS=Chlamydia muridarum (strain MoPn / Nigg) GN=trxA PE=3 SV=1 24 126 1.0E-07
sp|Q09433|THIO1_CAEEL Thioredoxin-1 OS=Caenorhabditis elegans GN=trx-1 PE=2 SV=1 40 98 1.0E-07
sp|Q8BND5|QSOX1_MOUSE Sulfhydryl oxidase 1 OS=Mus musculus GN=Qsox1 PE=1 SV=1 45 104 1.0E-07
sp|O84544|THIO_CHLTR Thioredoxin OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=trxA PE=3 SV=1 24 126 1.0E-07
sp|P40557|EPS1_YEAST ER-retained PMA1-suppressing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EPS1 PE=1 SV=1 38 101 1.0E-07
sp|Q69AB2|TXND8_MOUSE Thioredoxin domain-containing protein 8 OS=Mus musculus GN=Txndc8 PE=1 SV=1 29 111 1.0E-07
sp|Q8IXB1|DJC10_HUMAN DnaJ homolog subfamily C member 10 OS=Homo sapiens GN=DNAJC10 PE=1 SV=2 24 115 2.0E-07
sp|Q5R5L3|DJC10_PONAB DnaJ homolog subfamily C member 10 OS=Pongo abelii GN=DNAJC10 PE=2 SV=1 24 115 2.0E-07
sp|Q921X9|PDIA5_MOUSE Protein disulfide-isomerase A5 OS=Mus musculus GN=Pdia5 PE=1 SV=1 349 457 2.0E-07
sp|O81332|TRXF_MESCR Thioredoxin F-type, chloroplastic OS=Mesembryanthemum crystallinum PE=2 SV=1 42 114 2.0E-07
sp|Q8TFM8|THIO_FUSCU Thioredoxin-like protein OS=Fusarium culmorum PE=1 SV=1 25 113 2.0E-07
sp|Q8JGM4|QSOX1_CHICK Sulfhydryl oxidase 1 OS=Gallus gallus GN=QSOX1 PE=1 SV=1 45 104 2.0E-07
sp|O83889|THIO_TREPA Thioredoxin OS=Treponema pallidum (strain Nichols) GN=trxA PE=3 SV=1 36 107 2.0E-07
sp|Q17424|THIO2_CAEEL Probable thioredoxin-2 OS=Caenorhabditis elegans GN=trx-2 PE=3 SV=2 31 112 2.0E-07
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 20 119 2.0E-07
sp|P48384|TRXM_PEA Thioredoxin M-type, chloroplastic OS=Pisum sativum PE=2 SV=1 358 446 2.0E-07
sp|Q5I0H9|PDIA5_RAT Protein disulfide-isomerase A5 OS=Rattus norvegicus GN=Pdia5 PE=2 SV=1 368 457 3.0E-07
sp|Q7KQL8|THIO_PLAF7 Thioredoxin OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0545 PE=1 SV=1 358 459 3.0E-07
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 32 116 3.0E-07
sp|P10473|THIO_RHORU Thioredoxin OS=Rhodospirillum rubrum GN=trxA PE=1 SV=1 24 102 3.0E-07
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 358 460 4.0E-07
sp|Q14554|PDIA5_HUMAN Protein disulfide-isomerase A5 OS=Homo sapiens GN=PDIA5 PE=1 SV=1 368 457 4.0E-07
sp|P52233|THIO_ACIFR Thioredoxin OS=Acidithiobacillus ferrooxidans GN=trxA PE=3 SV=1 34 103 4.0E-07
sp|O14463|TRX1_SCHPO Thioredoxin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx1 PE=3 SV=3 366 459 4.0E-07
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 45 104 4.0E-07
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 34 119 4.0E-07
sp|Q00002|PDI_ALTAL Protein disulfide-isomerase (Fragment) OS=Alternaria alternata PE=1 SV=2 33 81 5.0E-07
sp|P0A4L2|THIO1_NOSSO Thioredoxin-1 OS=Nostoc sp. (strain ATCC 29151 / PCC 7119) GN=trxA PE=1 SV=2 370 442 5.0E-07
sp|P0A4L1|THIO1_NOSS1 Thioredoxin-1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxA PE=3 SV=2 370 442 5.0E-07
sp|O22022|THIO_CYAME Thioredoxin OS=Cyanidioschyzon merolae GN=trxA PE=3 SV=1 366 454 5.0E-07
sp|P0AA30|THIO_SHIFL Thioredoxin-1 OS=Shigella flexneri GN=trxA PE=3 SV=2 20 102 5.0E-07
sp|P0AA28|THIO_SALTY Thioredoxin-1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=trxA PE=3 SV=2 20 102 5.0E-07
sp|P0AA29|THIO_SALTI Thioredoxin-1 OS=Salmonella typhi GN=trxA PE=3 SV=2 20 102 5.0E-07
sp|P0AA25|THIO_ECOLI Thioredoxin-1 OS=Escherichia coli (strain K12) GN=trxA PE=1 SV=2 20 102 5.0E-07
sp|P0AA26|THIO_ECOL6 Thioredoxin-1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=trxA PE=3 SV=2 20 102 5.0E-07
sp|P0AA27|THIO_ECO57 Thioredoxin-1 OS=Escherichia coli O157:H7 GN=trxA PE=1 SV=2 20 102 5.0E-07
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 27 123 5.0E-07
sp|P52227|THIO_CHLCV Thioredoxin OS=Chlamydophila caviae (strain GPIC) GN=trxA PE=3 SV=1 24 127 5.0E-07
sp|Q851R5|TRH22_ORYSJ Thioredoxin H2-2 OS=Oryza sativa subsp. japonica GN=Os03g0800700 PE=2 SV=1 39 115 5.0E-07
sp|Q9H3N1|TMX1_HUMAN Thioredoxin-related transmembrane protein 1 OS=Homo sapiens GN=TMX1 PE=1 SV=1 358 463 5.0E-07
sp|P52231|THIO_SYNY3 Thioredoxin OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=trxA PE=1 SV=3 365 442 6.0E-07
sp|Q8KE49|THIO2_CHLTE Thioredoxin-2 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx2 PE=3 SV=3 34 119 6.0E-07
sp|Q7TN22|TXD16_MOUSE Thioredoxin domain-containing protein 16 OS=Mus musculus GN=Txndc16 PE=2 SV=1 26 254 6.0E-07
sp|P47370|THIO_MYCGE Thioredoxin OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=trxA PE=3 SV=1 30 119 6.0E-07
sp|Q7M1B9|THIO_CHLAA Thioredoxin OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=trxA PE=1 SV=3 36 114 6.0E-07
sp|P66928|THIO_HELPY Thioredoxin OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=trxA PE=3 SV=1 22 98 6.0E-07
sp|P66929|THIO_HELPJ Thioredoxin OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=trxA PE=3 SV=1 22 98 6.0E-07
sp|O17486|THIO_ECHGR Thioredoxin OS=Echinococcus granulosus GN=TRX PE=3 SV=2 19 116 6.0E-07
sp|P22803|TRX2_YEAST Thioredoxin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRX2 PE=1 SV=3 363 458 7.0E-07
sp|Q9UW02|THIO_COPCM Thioredoxin OS=Coprinus comatus PE=1 SV=1 32 102 7.0E-07
sp|Q8KEA4|THIO1_CHLTE Thioredoxin-1 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=trx1 PE=3 SV=1 362 440 7.0E-07
sp|Q6IUU3|QSOX1_RAT Sulfhydryl oxidase 1 OS=Rattus norvegicus GN=Qsox1 PE=1 SV=1 357 443 7.0E-07
sp|H2N4I1|QSOX1_PONAB Sulfhydryl oxidase 1 OS=Pongo abelii GN=QSOX1 PE=3 SV=2 45 141 7.0E-07
sp|Q9XFH9|TRXF2_ARATH Thioredoxin F2, chloroplastic OS=Arabidopsis thaliana GN=At5g16400 PE=2 SV=1 12 119 7.0E-07
sp|P34723|THIO_PENCH Thioredoxin OS=Penicillium chrysogenum GN=TRXA PE=1 SV=1 366 463 8.0E-07
sp|Q39362|TRXH2_BRANA Thioredoxin H-type 2 OS=Brassica napus GN=THL-2 PE=2 SV=1 38 127 8.0E-07
sp|P29450|TRXF_PEA Thioredoxin F-type, chloroplastic OS=Pisum sativum PE=2 SV=1 15 121 8.0E-07
sp|P10472|THIO_CHLTI Thioredoxin OS=Chlorobaculum thiosulfatiphilum GN=trxA PE=1 SV=5 364 464 9.0E-07
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 24 119 9.0E-07
sp|Q2KIL5|PDIA5_BOVIN Protein disulfide-isomerase A5 OS=Bos taurus GN=PDIA5 PE=2 SV=1 351 462 1.0E-06
sp|Q9ZP20|TRXM5_ORYSJ Thioredoxin M5, chloroplastic OS=Oryza sativa subsp. japonica GN=TRXM PE=2 SV=1 30 119 1.0E-06
sp|P07591|TRXM_SPIOL Thioredoxin M-type, chloroplastic OS=Spinacia oleracea PE=1 SV=2 347 404 1.0E-06
sp|Q9XFH8|TRXF1_ARATH Thioredoxin F1, chloroplastic OS=Arabidopsis thaliana GN=At3g02730 PE=1 SV=2 12 127 1.0E-06
sp|P96132|THIO_THIRO Thioredoxin (Fragment) OS=Thiocapsa roseopersicina GN=trxA PE=3 SV=1 20 102 1.0E-06
sp|Q99316|MPD2_YEAST Protein disulfide isomerase MPD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD2 PE=1 SV=1 349 472 1.0E-06
sp|P57653|THIO_BUCAI Thioredoxin OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=trxA PE=3 SV=1 364 464 1.0E-06
sp|Q6Z4I3|TRH21_ORYSJ Thioredoxin H2-1 OS=Oryza sativa subsp. japonica GN=Os07g0190800 PE=2 SV=1 32 115 1.0E-06
sp|O48897|TRXF_BRANA Thioredoxin F-type, chloroplastic OS=Brassica napus GN=TRXF PE=2 SV=1 12 119 1.0E-06
sp|P75512|THIO_MYCPN Thioredoxin OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=trxA PE=3 SV=1 30 119 1.0E-06
sp|O00391|QSOX1_HUMAN Sulfhydryl oxidase 1 OS=Homo sapiens GN=QSOX1 PE=1 SV=3 45 141 1.0E-06
sp|P50338|THIO_GRIPA Thioredoxin OS=Griffithsia pacifica GN=trxA PE=3 SV=2 358 442 2.0E-06
sp|P80579|THIO_ALIAC Thioredoxin OS=Alicyclobacillus acidocaldarius GN=trxA PE=1 SV=1 365 460 2.0E-06
sp|P97493|THIOM_MOUSE Thioredoxin, mitochondrial OS=Mus musculus GN=Txn2 PE=1 SV=1 353 463 2.0E-06
sp|P97615|THIOM_RAT Thioredoxin, mitochondrial OS=Rattus norvegicus GN=Txn2 PE=2 SV=1 353 463 2.0E-06
sp|O30974|THIO_MYCSM Thioredoxin OS=Mycobacterium smegmatis GN=trxA PE=3 SV=1 370 441 2.0E-06
sp|Q8LD49|TRXX_ARATH Thioredoxin X, chloroplastic OS=Arabidopsis thaliana GN=ATHX PE=2 SV=2 356 452 2.0E-06
sp|Q99757|THIOM_HUMAN Thioredoxin, mitochondrial OS=Homo sapiens GN=TXN2 PE=1 SV=2 353 463 2.0E-06
sp|P20857|THIO2_NOSS1 Thioredoxin-2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=trxB PE=1 SV=3 34 123 2.0E-06
sp|P37395|THIO_CYACA Thioredoxin OS=Cyanidium caldarium GN=trxA PE=3 SV=1 365 442 3.0E-06
sp|Q41864|TRXM_MAIZE Thioredoxin M-type, chloroplastic OS=Zea mays GN=TRM1 PE=2 SV=1 29 103 3.0E-06
sp|P12243|THIO1_SYNE7 Thioredoxin-1 OS=Synechococcus elongatus (strain PCC 7942) GN=trxA PE=3 SV=2 361 442 3.0E-06
sp|Q9Z7P5|THIO_CHLPN Thioredoxin OS=Chlamydia pneumoniae GN=trxA PE=3 SV=1 24 127 3.0E-06
sp|Q4UNK3|THIO_RICFE Thioredoxin OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=trxA PE=3 SV=2 34 119 3.0E-06
sp|P09857|THIO_ALLVI Thioredoxin OS=Allochromatium vinosum GN=trxA PE=1 SV=1 20 103 3.0E-06
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 365 440 3.0E-06
sp|P43785|THIO_HAEIN Thioredoxin OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=trxA PE=3 SV=1 22 102 3.0E-06
sp|Q6NPF9|TRXY1_ARATH Thioredoxin Y1, chloroplastic OS=Arabidopsis thaliana GN=At1g76760 PE=2 SV=1 365 468 4.0E-06
sp|Q8IFW4|THIOT_DROME Thioredoxin-T OS=Drosophila melanogaster GN=TrxT PE=2 SV=1 35 103 4.0E-06
sp|P07887|THIO2_CORNE Thioredoxin C-2 OS=Corynebacterium nephridii PE=1 SV=3 34 102 4.0E-06
sp|P59527|THIO_BUCBP Thioredoxin OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=trxA PE=3 SV=1 366 437 4.0E-06
sp|Q7X8R5|TRXM2_ORYSJ Thioredoxin M2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os04g0530600 PE=2 SV=2 10 119 4.0E-06
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase OS=Caenorhabditis briggsae GN=png-1 PE=3 SV=1 38 215 4.0E-06
sp|O96952|THIO_GEOCY Thioredoxin OS=Geodia cydonium GN=THIO PE=3 SV=1 24 110 5.0E-06
sp|P52230|THIO1_STRCO Thioredoxin-1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=trxA PE=1 SV=4 365 440 6.0E-06
sp|P21609|THIO_CLOLI Thioredoxin OS=Clostridium litorale GN=trxA PE=1 SV=2 370 464 6.0E-06
sp|Q1RKN1|THIO_RICBR Thioredoxin OS=Rickettsia bellii (strain RML369-C) GN=trxA PE=3 SV=2 30 115 6.0E-06
sp|P00275|THIO1_CORNE Thioredoxin C-1 OS=Corynebacterium nephridii PE=1 SV=1 365 440 7.0E-06
sp|Q9CM49|THIO_PASMU Thioredoxin OS=Pasteurella multocida (strain Pm70) GN=trxA PE=3 SV=1 368 464 7.0E-06
sp|Q7XKD0|TRXX_ORYSJ Thioredoxin X, chloroplastic OS=Oryza sativa subsp. japonica GN=TRX-X PE=2 SV=1 34 137 7.0E-06
sp|Q95108|THIOM_BOVIN Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 353 463 9.0E-06
sp|Q95108|THIOM_BOVIN Thioredoxin, mitochondrial OS=Bos taurus GN=TXN2 PE=1 SV=2 33 125 9.0E-06
sp|Q38879|TRXH2_ARATH Thioredoxin H2 OS=Arabidopsis thaliana GN=TRX2 PE=2 SV=2 32 115 9.0E-06
sp|Q9ZEE0|THIO_RICPR Thioredoxin OS=Rickettsia prowazekii (strain Madrid E) GN=trxA PE=3 SV=2 24 119 9.0E-06
sp|O94504|TRX2_SCHPO Thioredoxin-2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trx2 PE=1 SV=2 30 102 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005509 calcium ion binding Yes
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0005488 binding No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1928
MHHNRLAFGLVAALAGVATADSHVHQLKKKSFDDFVSSNQLVLAKFYAPWCGHCKALAPEYEEAASSLKEKDIKL
VKIDCTEEADLCQQHGVEGYPTLKVFRGLKNVSPYNGQRKADAIHSYMVKQSMPAVSILTKATLEDFKSTDKVVV
IAYISADDKSSNETFTAVAESLRDDYLFGGVNDASVAEAEGVKFPSIVLYKDFDEGKNTFTGEFDIDAIKDFAKV
SATPLVGEVGPETYASYMSAAIPLGYIFAETKEEREELAKTLKPVAEKYKGKINFATIDAKQFGAHATNLNLKSD
KFPCFAIQDTVKNYKYPFDQDKEVTHENIAKFVDDFSAGKIEPSIKSEPIPEVQEGPVTVVVAKNYEDIVLDDAK
DVLIEFYAPWCGHCKALAPKYEELAKQYADSEFKDKVVIAKVDATANDVPDDVSGFPTIKMYPAGGKDSPVTYSG
SRTIEDLIKFIKENGKYKAEISIKEEATEEAAPAATEAKEDKKAKEDKEDKEDKEDKEDKEDKKKAKEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGQGRQGGRRP*
Coding >OphauG2|1928
ATGCATCACAACCGCCTCGCCTTTGGCCTCGTCGCCGCCCTCGCTGGTGTCGCCACAGCCGACTCGCATGTCCAC
CAACTAAAAAAAAAGTCATTTGACGACTTTGTTAGCTCGAACCAGCTCGTCCTGGCCAAATTCTACGCTCCTTGG
TGCGGTCACTGCAAGGCTCTGGCCCCCGAATACGAGGAGGCGGCCTCATCCCTCAAAGAAAAGGACATTAAACTC
GTCAAGATTGACTGCACCGAAGAGGCCGATCTCTGCCAGCAGCATGGCGTCGAGGGCTACCCTACCCTCAAGGTG
TTTCGCGGTCTCAAAAACGTTAGCCCTTACAATGGCCAGCGCAAAGCTGACGCCATCCACTCATACATGGTCAAA
CAATCCATGCCCGCTGTCTCCATCTTGACAAAGGCCACTCTTGAAGACTTCAAATCGACCGACAAGGTGGTGGTG
ATTGCCTACATATCAGCCGATGACAAGAGCTCAAACGAGACCTTTACCGCTGTCGCCGAGTCGCTGCGCGATGAT
TACTTGTTTGGAGGCGTCAATGACGCTTCTGTTGCTGAGGCTGAAGGCGTCAAGTTTCCTTCCATTGTCCTCTAC
AAGGACTTTGACGAGGGCAAGAATACATTTACCGGCGAGTTTGACATTGACGCAATCAAGGACTTCGCCAAAGTT
TCAGCAACACCCCTTGTCGGCGAGGTTGGCCCCGAGACTTACGCTTCGTACATGTCTGCCGCCATCCCACTGGGC
TACATTTTTGCCGAGACCAAGGAAGAGCGCGAGGAGCTTGCCAAAACCCTCAAGCCCGTTGCCGAAAAGTACAAG
GGCAAGATCAACTTTGCCACCATCGATGCCAAGCAGTTTGGCGCTCATGCTACCAACCTCAATCTCAAGTCGGAC
AAGTTCCCTTGCTTTGCAATTCAGGACACGGTCAAGAATTACAAGTATCCATTTGATCAGGACAAGGAGGTGACG
CATGAAAACATTGCCAAATTTGTCGATGATTTCTCTGCCGGCAAGATTGAGCCCAGCATCAAGTCGGAGCCCATC
CCCGAGGTGCAGGAGGGACCAGTCACTGTTGTTGTTGCCAAGAACTATGAAGACATTGTTCTTGACGATGCCAAG
GACGTCTTGATTGAGTTTTATGCTCCTTGGTGTGGTCACTGCAAGGCTCTGGCCCCCAAGTACGAAGAACTTGCC
AAGCAGTACGCCGATAGTGAGTTCAAGGACAAGGTTGTCATTGCCAAGGTTGATGCCACGGCAAACGACGTGCCT
GACGATGTGTCTGGTTTCCCCACCATCAAAATGTACCCGGCTGGTGGCAAGGACTCGCCCGTTACTTACAGCGGC
TCGCGCACTATTGAGGATCTCATCAAGTTCATCAAGGAGAACGGCAAGTACAAGGCTGAAATTTCTATCAAGGAG
GAGGCTACCGAAGAGGCTGCCCCAGCCGCTACTGAAGCCAAGGAGGACAAGAAGGCCAAGGAGGACAAGGAGGAC
AAGGAGGACAAGGAGGACAAGGAGGACAAGGAGGACAAGAAGAAGGCCAAGGAGGANNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNAGGAGGACAAGGAAGACAAGGAGGCCGACGACCATGA
Transcript >OphauG2|1928
ATGCATCACAACCGCCTCGCCTTTGGCCTCGTCGCCGCCCTCGCTGGTGTCGCCACAGCCGACTCGCATGTCCAC
CAACTAAAAAAAAAGTCATTTGACGACTTTGTTAGCTCGAACCAGCTCGTCCTGGCCAAATTCTACGCTCCTTGG
TGCGGTCACTGCAAGGCTCTGGCCCCCGAATACGAGGAGGCGGCCTCATCCCTCAAAGAAAAGGACATTAAACTC
GTCAAGATTGACTGCACCGAAGAGGCCGATCTCTGCCAGCAGCATGGCGTCGAGGGCTACCCTACCCTCAAGGTG
TTTCGCGGTCTCAAAAACGTTAGCCCTTACAATGGCCAGCGCAAAGCTGACGCCATCCACTCATACATGGTCAAA
CAATCCATGCCCGCTGTCTCCATCTTGACAAAGGCCACTCTTGAAGACTTCAAATCGACCGACAAGGTGGTGGTG
ATTGCCTACATATCAGCCGATGACAAGAGCTCAAACGAGACCTTTACCGCTGTCGCCGAGTCGCTGCGCGATGAT
TACTTGTTTGGAGGCGTCAATGACGCTTCTGTTGCTGAGGCTGAAGGCGTCAAGTTTCCTTCCATTGTCCTCTAC
AAGGACTTTGACGAGGGCAAGAATACATTTACCGGCGAGTTTGACATTGACGCAATCAAGGACTTCGCCAAAGTT
TCAGCAACACCCCTTGTCGGCGAGGTTGGCCCCGAGACTTACGCTTCGTACATGTCTGCCGCCATCCCACTGGGC
TACATTTTTGCCGAGACCAAGGAAGAGCGCGAGGAGCTTGCCAAAACCCTCAAGCCCGTTGCCGAAAAGTACAAG
GGCAAGATCAACTTTGCCACCATCGATGCCAAGCAGTTTGGCGCTCATGCTACCAACCTCAATCTCAAGTCGGAC
AAGTTCCCTTGCTTTGCAATTCAGGACACGGTCAAGAATTACAAGTATCCATTTGATCAGGACAAGGAGGTGACG
CATGAAAACATTGCCAAATTTGTCGATGATTTCTCTGCCGGCAAGATTGAGCCCAGCATCAAGTCGGAGCCCATC
CCCGAGGTGCAGGAGGGACCAGTCACTGTTGTTGTTGCCAAGAACTATGAAGACATTGTTCTTGACGATGCCAAG
GACGTCTTGATTGAGTTTTATGCTCCTTGGTGTGGTCACTGCAAGGCTCTGGCCCCCAAGTACGAAGAACTTGCC
AAGCAGTACGCCGATAGTGAGTTCAAGGACAAGGTTGTCATTGCCAAGGTTGATGCCACGGCAAACGACGTGCCT
GACGATGTGTCTGGTTTCCCCACCATCAAAATGTACCCGGCTGGTGGCAAGGACTCGCCCGTTACTTACAGCGGC
TCGCGCACTATTGAGGATCTCATCAAGTTCATCAAGGAGAACGGCAAGTACAAGGCTGAAATTTCTATCAAGGAG
GAGGCTACCGAAGAGGCTGCCCCAGCCGCTACTGAAGCCAAGGAGGACAAGAAGGCCAAGGAGGACAAGGAGGAC
AAGGAGGACAAGGAGGACAAGGAGGACAAGGAGGACAAGAAGAAGGCCAAGGAGGANNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNAGGAGGACAAGGAAGACAAGGAGGCCGACGACCATGA
Gene >OphauG2|1928
ATGCATCACAACCGCCTCGCCTTTGGCCTCGTCGCCGCCCTCGCTGGTGTCGCCACAGCCGACTCGCATGTCCAC
CAACTAAAAAAAAAGTCATTTGACGACTTTGTTAGCTCGAACCAGCTCGTCCTGGCCAAATGTTGGTCCCCCTTT
CACCCTCATCCAACACACAGCATTCTGACACTTGGGCTCTAGTCTACGCTCCTTGGTGCGGTCACTGCAAGGCTC
TGGCCCCCGAATACGAGGAGGCGGCCTCATCCCTCAAAGAAAAGGACATTAAACTCGTCAAGATTGACTGCACCG
AAGAGGCCGATCTCTGCCAGCAGCATGGCGTCGAGGGCTACCCTACCCTCAAGGTGTTTCGCGGTCTCAAAAACG
TTAGCCCTTACAATGGCCAGCGCAAAGCTGACGCGTGAGTTGCTCACCTCCTGTTGTAATGGCGCCGACTTGGGC
TCACTCATCTCTCTGCTAGCATCCACTCATACATGGTCAAACAATCCATGCCCGCTGTCTCCATCTTGACAAAGG
CCACTCTTGAAGACTTCAAATCGACCGACAAGGTGGTGGTGATTGCCTACATATCAGCCGATGACAAGAGCTCAA
ACGAGACCTTTACCGCTGTCGCCGAGTCGCTGCGCGATGATTACTTGTTTGGAGGCGTCAATGACGCTTCTGTTG
CTGAGGCTGAAGGCGTCAAGTTTCCTTCCATTGTCCTCTACAAGGACTTTGACGAGGGCAAGAATACATTTACCG
GCGAGTTTGACATTGACGCAATCAAGGACTTCGCCAAAGTTTCAGCAACACCCCTTGTCGGCGAGGTTGGCCCCG
AGACTTACGCTTCGTACATGTCTGCCGCCATCCCACTGGGCTACATTTTTGCCGAGACCAAGGAAGAGCGCGAGG
AGCTTGCCAAAACCCTCAAGCCCGTTGCCGAAAAGTACAAGGGCAAGATCAACTTTGCCACCATCGATGCCAAGC
AGTTTGGCGCTCATGCTACCAACCTCAATCTCAAGTCGGACAAGTTCCCTTGCTTTGCAATTCAGGACACGGTCA
AGAATTACAAGTATCCATTTGATCAGGACAAGGAGGTGACGCATGAAAACATTGCCAAATTTGTCGATGATTTCT
CTGCCGGCAAGATTGAGCCCAGCATCAAGTCGGAGCCCATCCCCGAGGTGCAGGAGGGACCAGTCACTGTTGTTG
TTGCCAAGAACTATGAAGACATTGTTCTTGACGATGCCAAGGACGTCTTGATTGAGTTTTATGCTCCTTGGTGTG
GTCACTGCAAGGCTCTGGCCCCCAAGTACGAAGAACTTGCCAAGCAGTACGCCGATAGTGAGTTCAAGGACAAGG
TTGTCATTGCCAAGGTTGATGCCACGGCAAACGACGTGCCTGACGATGTGTCTGGTTTCCCCACCATCAAAATGT
ACCCGGCTGGTGGCAAGGACTCGCCCGTTACTTACAGCGGCTCGCGCACTATTGAGGATCTCATCAAGTTCATCA
AGGAGAACGGCAAGTACAAGGCTGAAATTTCTATCAAGGAGGAGGCTACCGAAGAGGCTGCCCCAGCCGCTACTG
AAGCCAAGGAGGACAAGAAGGCCAAGGAGGACAAGGAGGACAAGGAGGACAAGGAGGACAAGGAGGACAAGGAGG
ACAAGAAGAAGGCCAAGGAGGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAGGAGGACAAGGAAGAC
AAGGAGGCCGACGACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail