Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1927
Gene name
LocationContig_1623:2127..2958
Strand-
Gene length (bp)831
Transcript length (bp)831
Coding sequence length (bp)831
Protein length (aa) 277

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07542 ATP12 ATP12 chaperone protein 2.1E-35 9 141

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UT16|ATP12_SCHPO Protein atp12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=atp12 PE=3 SV=2 11 264 1.0E-29
sp|P22135|ATP12_YEAST Protein ATP12, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP12 PE=1 SV=2 11 262 3.0E-22
sp|Q1LZ96|ATPF2_BOVIN ATP synthase mitochondrial F1 complex assembly factor 2 OS=Bos taurus GN=ATPAF2 PE=2 SV=1 11 269 7.0E-10
sp|Q91YY4|ATPF2_MOUSE ATP synthase mitochondrial F1 complex assembly factor 2 OS=Mus musculus GN=Atpaf2 PE=1 SV=1 11 269 4.0E-08
sp|Q8N5M1|ATPF2_HUMAN ATP synthase mitochondrial F1 complex assembly factor 2 OS=Homo sapiens GN=ATPAF2 PE=1 SV=1 11 267 5.0E-08

GO

GO Term Description Terminal node
GO:0043461 proton-transporting ATP synthase complex assembly Yes
GO:0016043 cellular component organization No
GO:0043933 protein-containing complex organization No
GO:0071840 cellular component organization or biogenesis No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0022607 cellular component assembly No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4219
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1927 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7437
Ophiocordyceps camponoti-floridani Ophcf2|06220
Ophiocordyceps camponoti-rufipedis Ophun1|4394
Ophiocordyceps kimflemingae Ophio5|4907
Ophiocordyceps subramaniannii Hirsu2|8611

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1927
MAAVLKSNHIGSLQIHLDSRPLRHPQTREVIKLPPSKTNLAAALALEWDSLTSAQQATKQHLIPLTSIICRALDI
EKDDESSAPSLGKIRTDIAASVMRYLDTDTLLCWAPPPGEFDLRNKAGEALRDVQMKVAGETLAFLATHVWPNIT
IEPVLDGHCIVPRPQAEGVREAIQGWVEGLNAWDLAGLERAVLAGKSLVAAARLVAEWSESPVGRHVPVTTQRFG
IEEAARALNIEIDWQTSRWGEIEETHDVNNEDMRRQLGSVFLIVSGAGKPF*
Coding >OphauG2|1927
ATGGCTGCCGTGCTAAAGTCGAATCACATAGGCTCCTTGCAGATACATCTCGATTCCAGGCCACTCAGGCATCCC
CAGACACGGGAAGTCATAAAGCTTCCGCCATCCAAAACCAATCTAGCCGCTGCTCTCGCCCTTGAGTGGGATTCG
TTGACATCGGCGCAACAGGCCACCAAGCAACACCTCATTCCGCTTACCAGCATCATCTGTCGAGCTCTAGACATT
GAAAAGGATGATGAGTCGAGTGCGCCCAGTCTGGGCAAAATTCGCACCGACATTGCCGCGTCGGTCATGCGATAT
CTCGACACAGACACACTGCTATGCTGGGCGCCGCCCCCCGGTGAATTCGACCTTCGCAACAAGGCTGGTGAAGCG
CTACGAGACGTCCAGATGAAGGTGGCTGGGGAGACATTGGCCTTCTTGGCCACCCATGTGTGGCCCAACATCACA
ATCGAGCCCGTGCTTGACGGACACTGCATTGTGCCGCGCCCGCAGGCTGAAGGCGTGAGGGAGGCTATTCAAGGC
TGGGTGGAAGGGCTCAATGCGTGGGATCTAGCTGGGCTAGAACGGGCAGTGCTTGCGGGGAAAAGCCTAGTAGCG
GCGGCCAGACTAGTAGCCGAGTGGAGCGAGAGCCCAGTTGGACGCCATGTGCCAGTCACGACGCAAAGATTTGGC
ATCGAAGAAGCGGCCAGAGCACTCAATATTGAGATTGACTGGCAGACTTCTCGGTGGGGTGAAATTGAGGAGACG
CATGACGTCAACAATGAAGACATGAGGCGACAACTTGGAAGCGTGTTTTTGATCGTGTCGGGGGCTGGAAAGCCC
TTTTGA
Transcript >OphauG2|1927
ATGGCTGCCGTGCTAAAGTCGAATCACATAGGCTCCTTGCAGATACATCTCGATTCCAGGCCACTCAGGCATCCC
CAGACACGGGAAGTCATAAAGCTTCCGCCATCCAAAACCAATCTAGCCGCTGCTCTCGCCCTTGAGTGGGATTCG
TTGACATCGGCGCAACAGGCCACCAAGCAACACCTCATTCCGCTTACCAGCATCATCTGTCGAGCTCTAGACATT
GAAAAGGATGATGAGTCGAGTGCGCCCAGTCTGGGCAAAATTCGCACCGACATTGCCGCGTCGGTCATGCGATAT
CTCGACACAGACACACTGCTATGCTGGGCGCCGCCCCCCGGTGAATTCGACCTTCGCAACAAGGCTGGTGAAGCG
CTACGAGACGTCCAGATGAAGGTGGCTGGGGAGACATTGGCCTTCTTGGCCACCCATGTGTGGCCCAACATCACA
ATCGAGCCCGTGCTTGACGGACACTGCATTGTGCCGCGCCCGCAGGCTGAAGGCGTGAGGGAGGCTATTCAAGGC
TGGGTGGAAGGGCTCAATGCGTGGGATCTAGCTGGGCTAGAACGGGCAGTGCTTGCGGGGAAAAGCCTAGTAGCG
GCGGCCAGACTAGTAGCCGAGTGGAGCGAGAGCCCAGTTGGACGCCATGTGCCAGTCACGACGCAAAGATTTGGC
ATCGAAGAAGCGGCCAGAGCACTCAATATTGAGATTGACTGGCAGACTTCTCGGTGGGGTGAAATTGAGGAGACG
CATGACGTCAACAATGAAGACATGAGGCGACAACTTGGAAGCGTGTTTTTGATCGTGTCGGGGGCTGGAAAGCCC
TTTTGA
Gene >OphauG2|1927
ATGGCTGCCGTGCTAAAGTCGAATCACATAGGCTCCTTGCAGATACATCTCGATTCCAGGCCACTCAGGCATCCC
CAGACACGGGAAGTCATAAAGCTTCCGCCATCCAAAACCAATCTAGCCGCTGCTCTCGCCCTTGAGTGGGATTCG
TTGACATCGGCGCAACAGGCCACCAAGCAACACCTCATTCCGCTTACCAGCATCATCTGTCGAGCTCTAGACATT
GAAAAGGATGATGAGTCGAGTGCGCCCAGTCTGGGCAAAATTCGCACCGACATTGCCGCGTCGGTCATGCGATAT
CTCGACACAGACACACTGCTATGCTGGGCGCCGCCCCCCGGTGAATTCGACCTTCGCAACAAGGCTGGTGAAGCG
CTACGAGACGTCCAGATGAAGGTGGCTGGGGAGACATTGGCCTTCTTGGCCACCCATGTGTGGCCCAACATCACA
ATCGAGCCCGTGCTTGACGGACACTGCATTGTGCCGCGCCCGCAGGCTGAAGGCGTGAGGGAGGCTATTCAAGGC
TGGGTGGAAGGGCTCAATGCGTGGGATCTAGCTGGGCTAGAACGGGCAGTGCTTGCGGGGAAAAGCCTAGTAGCG
GCGGCCAGACTAGTAGCCGAGTGGAGCGAGAGCCCAGTTGGACGCCATGTGCCAGTCACGACGCAAAGATTTGGC
ATCGAAGAAGCGGCCAGAGCACTCAATATTGAGATTGACTGGCAGACTTCTCGGTGGGGTGAAATTGAGGAGACG
CATGACGTCAACAATGAAGACATGAGGCGACAACTTGGAAGCGTGTTTTTGATCGTGTCGGGGGCTGGAAAGCCC
TTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail