Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1911
Gene name
LocationContig_1618:274..2235
Strand-
Gene length (bp)1961
Transcript length (bp)1908
Coding sequence length (bp)1908
Protein length (aa) 636

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 1.2E-40 418 605
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 2.8E-07 316 398

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04802|SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPS1 PE=1 SV=3 314 616 5.0E-75
sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus GN=DARS PE=2 SV=1 301 616 2.0E-73
sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus GN=Dars PE=1 SV=2 316 616 2.0E-72
sp|P15178|SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Dars PE=2 SV=1 316 616 6.0E-72
sp|Q5R9I5|SYDC_PONAB Aspartate--tRNA ligase, cytoplasmic OS=Pongo abelii GN=DARS PE=2 SV=1 316 616 1.0E-71
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04802|SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPS1 PE=1 SV=3 314 616 5.0E-75
sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus GN=DARS PE=2 SV=1 301 616 2.0E-73
sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus GN=Dars PE=1 SV=2 316 616 2.0E-72
sp|P15178|SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Dars PE=2 SV=1 316 616 6.0E-72
sp|Q5R9I5|SYDC_PONAB Aspartate--tRNA ligase, cytoplasmic OS=Pongo abelii GN=DARS PE=2 SV=1 316 616 1.0E-71
sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens GN=DARS PE=1 SV=2 316 616 2.0E-71
sp|Q8H104|SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana GN=At4g26870 PE=2 SV=1 277 616 3.0E-69
sp|Q75JQ1|SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum GN=aspS1 PE=3 SV=1 291 616 2.0E-67
sp|Q9M084|SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana GN=IBI1 PE=1 SV=1 277 616 4.0E-65
sp|O74407|SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 289 622 9.0E-65
sp|Q03577|SYDC_CAEEL Aspartate--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=drs-1 PE=3 SV=1 233 616 7.0E-64
sp|Q559M9|SYDC2_DICDI Aspartate--tRNA ligase, cytoplasmic 2 OS=Dictyostelium discoideum GN=aspS2 PE=3 SV=1 300 557 5.0E-47
sp|Q8TXG4|SYDND_METKA Aspartate--tRNA(Asp/Asn) ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aspS PE=3 SV=1 313 630 2.0E-44
sp|Q8SRQ8|SYDC_ENCCU Probable aspartate--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0790 PE=3 SV=1 334 616 3.0E-43
sp|Q9Y9U7|SYDND_AERPE Aspartate--tRNA(Asp/Asn) ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aspS PE=3 SV=2 332 602 3.0E-42
sp|Q58950|SYDND_METJA Aspartate--tRNA(Asp/Asn) ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aspS PE=3 SV=1 313 562 7.0E-41
sp|O29342|SYDND_ARCFU Aspartate--tRNA(Asp/Asn) ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aspS PE=3 SV=1 313 562 9.0E-41
sp|Q9HJM1|SYD_THEAC Aspartate--tRNA(Asp) ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=aspS PE=3 SV=1 313 612 1.0E-40
sp|Q6KZQ3|SYD_PICTO Aspartate--tRNA(Asp) ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=aspS PE=3 SV=1 330 547 1.0E-38
sp|Q976I3|SYDND_SULTO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspS PE=1 SV=1 313 613 2.0E-38
sp|O24822|SYDND_HALVO Aspartate--tRNA(Asp/Asn) ligase OS=Haloferax volcanii GN=aspS PE=3 SV=2 313 557 3.0E-37
sp|Q5V1N2|SYDND_HALMA Aspartate--tRNA(Asp/Asn) ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=aspS PE=3 SV=1 313 557 4.0E-37
sp|A9A945|SYDND_METM6 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=aspS PE=3 SV=1 292 535 5.0E-37
sp|A6VHK5|SYDND_METM7 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=aspS PE=3 SV=1 292 535 8.0E-37
sp|Q3IT59|SYDND_NATPD Aspartate--tRNA(Asp/Asn) ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=aspS PE=3 SV=1 313 557 9.0E-37
sp|B7XHQ4|SYDC_ENTBH Probable aspartate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21705 PE=3 SV=1 313 616 1.0E-36
sp|A6UQQ8|SYDND_METVS Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=aspS PE=3 SV=1 292 535 1.0E-36
sp|Q6LWU0|SYDND_METMP Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=aspS PE=3 SV=1 292 535 3.0E-36
sp|Q979P6|SYD_THEVO Aspartate--tRNA(Asp) ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=aspS PE=3 SV=1 327 613 9.0E-36
sp|Q466Y5|SYDND_METBF Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=aspS PE=3 SV=1 313 560 3.0E-35
sp|O26328|SYDND_METTH Aspartate--tRNA(Asp/Asn) ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aspS PE=1 SV=1 313 557 4.0E-35
sp|A4G0V5|SYDND_METM5 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=aspS PE=3 SV=1 292 535 7.0E-35
sp|Q18KP5|SYDND_HALWD Aspartate--tRNA(Asp/Asn) ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=aspS PE=3 SV=1 313 614 8.0E-35
sp|Q9V036|SYD_PYRAB Aspartate--tRNA(Asp) ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspS PE=3 SV=1 313 615 1.0E-34
sp|A6USZ9|SYDND_META3 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=aspS PE=3 SV=1 305 546 4.0E-34
sp|O58776|SYD_PYRHO Aspartate--tRNA(Asp) ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspS PE=3 SV=1 313 562 4.0E-34
sp|Q2FRU5|SYDND_METHJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=aspS PE=3 SV=1 331 557 8.0E-34
sp|Q12XU7|SYDND_METBU Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=aspS PE=3 SV=1 305 560 2.0E-33
sp|Q8Q0R2|SYDND_METMA Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aspS PE=1 SV=1 313 560 6.0E-33
sp|A2SPG1|SYDND_METLZ Aspartate--tRNA(Asp/Asn) ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=aspS PE=3 SV=1 322 544 8.0E-33
sp|Q8TQ68|SYDND_METAC Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aspS PE=3 SV=1 313 582 3.0E-32
sp|Q52428|SYD_THEKO Aspartate--tRNA(Asp) ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspS PE=1 SV=2 313 547 3.0E-32
sp|Q8ZYM8|SYD_PYRAE Aspartate--tRNA(Asp) ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aspS PE=1 SV=1 296 566 1.0E-31
sp|O07683|SYDND_HALSA Aspartate--tRNA(Asp/Asn) ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=aspS PE=1 SV=1 313 545 7.0E-31
sp|Q8U2G6|SYD_PYRFU Aspartate--tRNA(Asp) ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=aspS PE=3 SV=1 313 547 7.0E-31
sp|A3CXH4|SYDND_METMJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=aspS PE=3 SV=1 331 557 2.0E-30
sp|Q980V3|SYDND_SULSO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspS PE=3 SV=1 304 613 3.0E-30
sp|Q9RVH4|SYDND_DEIRA Aspartate--tRNA(Asp/Asn) ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aspS2 PE=1 SV=1 313 553 8.0E-29
sp|Q5SIC2|SYDND_THET8 Aspartate--tRNA(Asp/Asn) ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspS2 PE=1 SV=1 312 615 4.0E-28
sp|P54262|SYN_LACDA Asparagine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=asnS1 PE=3 SV=1 324 615 3.0E-27
sp|Q038W1|SYN_LACC3 Asparagine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=asnS PE=3 SV=1 324 627 4.0E-27
sp|Q5WGB1|SYN_BACSK Asparagine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=asnS PE=3 SV=1 302 563 3.0E-26
sp|Q49XR0|SYN_STAS1 Asparagine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=asnS PE=3 SV=1 301 610 3.0E-26
sp|Q8CSI9|SYN_STAES Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=asnS PE=3 SV=1 303 610 8.0E-26
sp|Q5HP89|SYN_STAEQ Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=asnS PE=3 SV=1 303 610 8.0E-26
sp|A3CNM0|SYN_STRSV Asparagine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=asnS PE=3 SV=1 312 611 1.0E-25
sp|Q8CWQ4|SYN_STRR6 Asparagine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=asnS PE=3 SV=1 312 569 1.0E-25
sp|Q04JK7|SYN_STRP2 Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=asnS PE=3 SV=1 312 569 1.0E-25
sp|A0AK01|SYN_LISW6 Asparagine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=asnS PE=3 SV=1 303 560 2.0E-25
sp|Q5JHC1|SYN_THEKO Asparagine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=asnS PE=3 SV=1 313 548 2.0E-25
sp|Q38X65|SYN_LACSS Asparagine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=asnS PE=3 SV=1 324 627 2.0E-25
sp|Q043G9|SYN_LACGA Asparagine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=asnS PE=3 SV=1 324 610 3.0E-25
sp|P58695|SYN_LISMO Asparagine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=asnS PE=3 SV=1 303 560 3.0E-25
sp|Q92AB2|SYN_LISIN Asparagine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=asnS PE=3 SV=1 303 560 3.0E-25
sp|Q97PR0|SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=asnS PE=1 SV=1 312 569 3.0E-25
sp|Q74JA9|SYN_LACJO Asparagine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=asnS PE=3 SV=1 324 610 3.0E-25
sp|B2GA02|SYN_LACRJ Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=asnS PE=3 SV=1 324 627 4.0E-25
sp|A5VMP9|SYN_LACRD Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=asnS PE=3 SV=1 324 627 4.0E-25
sp|C5A4R8|SYN_THEGJ Asparagine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=asnS PE=3 SV=1 313 548 4.0E-25
sp|Q9KC78|SYN_BACHD Asparagine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=asnS PE=3 SV=1 303 615 5.0E-25
sp|Q9V251|SYN_PYRAB Asparagine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=asnS PE=3 SV=1 313 548 6.0E-25
sp|Q4L6F8|SYN_STAHJ Asparagine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=asnS PE=3 SV=1 303 610 6.0E-25
sp|Q71YB9|SYN_LISMF Asparagine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=asnS PE=3 SV=1 303 560 6.0E-25
sp|Q831X4|SYN_ENTFA Asparagine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=asnS PE=3 SV=1 312 558 7.0E-25
sp|A7Z5Y7|SYN_BACMF Asparagine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=asnS PE=3 SV=1 303 563 7.0E-25
sp|Q65I63|SYN_BACLD Asparagine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=asnS PE=3 SV=1 303 615 7.0E-25
sp|Q979Y4|SYN_THEVO Asparagine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=asnS PE=3 SV=1 312 559 9.0E-25
sp|Q88Y40|SYN1_LACPL Asparagine--tRNA ligase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS1 PE=3 SV=1 301 559 1.0E-24
sp|Q8BP47|SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Nars PE=1 SV=2 313 558 1.0E-24
sp|Q8NWP3|SYN_STAAW Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|P67572|SYN_STAAN Asparagine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=asnS PE=1 SV=1 312 610 1.0E-24
sp|P67571|SYN_STAAM Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|A5ISY4|SYN_STAA9 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|A6U1S3|SYN_STAA2 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|A7X2E9|SYN_STAA1 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|Q1IHQ3|SYN_KORVE Asparagine--tRNA ligase OS=Koribacter versatilis (strain Ellin345) GN=asnS PE=3 SV=1 296 610 1.0E-24
sp|A8Z434|SYN_STAAT Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|A6QH05|SYN_STAAE Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|Q5HFW9|SYN_STAAC Asparagine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|Q2FYH6|SYN_STAA8 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|Q2FGY6|SYN_STAA3 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=asnS PE=3 SV=1 312 610 1.0E-24
sp|Q6G9A8|SYN_STAAS Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=asnS PE=3 SV=1 312 610 2.0E-24
sp|Q2YY52|SYN_STAAB Asparagine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=asnS PE=3 SV=1 312 610 2.0E-24
sp|Q6GGV5|SYN_STAAR Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=asnS PE=3 SV=1 312 610 2.0E-24
sp|O57980|SYN_PYRHO Asparagine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=asnS PE=1 SV=1 313 548 2.0E-24
sp|Q1J7K5|SYN_STRPF Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|P39772|SYN_BACSU Asparagine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=asnS PE=3 SV=2 303 615 3.0E-24
sp|P0DG29|SYN_STRPQ Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|Q48UH6|SYN_STRPM Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|A2RFM5|SYN_STRPG Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|Q1JHS6|SYN_STRPD Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|Q1JMN3|SYN_STRPC Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|Q1JCQ7|SYN_STRPB Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|P67577|SYN_STRP8 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|P0DG28|SYN_STRP3 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|P67575|SYN_STRP1 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=asnS PE=3 SV=1 312 569 3.0E-24
sp|Q5XD20|SYN_STRP6 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=asnS PE=3 SV=1 312 569 4.0E-24
sp|Q5M067|SYN_STRT1 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=asnS PE=3 SV=1 312 611 4.0E-24
sp|A8YVJ7|SYN_LACH4 Asparagine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=asnS PE=3 SV=1 324 610 4.0E-24
sp|Q2NHT0|SYDND_METST Aspartate--tRNA(Asp/Asn) ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aspS PE=3 SV=1 313 536 4.0E-24
sp|Q04EX6|SYN_OENOB Asparagine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=asnS PE=3 SV=1 325 563 5.0E-24
sp|P67574|SYN_STRA5 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=asnS PE=3 SV=1 312 569 6.0E-24
sp|P67573|SYN_STRA3 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=asnS PE=3 SV=1 312 569 6.0E-24
sp|Q3K2E5|SYN_STRA1 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=asnS PE=3 SV=1 312 569 6.0E-24
sp|Q5M4S8|SYN_STRT2 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=asnS PE=3 SV=1 312 611 1.0E-23
sp|A4IQ54|SYN_GEOTN Asparagine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=asnS PE=3 SV=1 303 535 1.0E-23
sp|Q8EQE2|SYN_OCEIH Asparagine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=asnS PE=3 SV=1 303 610 1.0E-23
sp|A4W083|SYN_STRS2 Asparagine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=asnS PE=3 SV=1 300 569 2.0E-23
sp|Q9HKS7|SYN_THEAC Asparagine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=asnS PE=3 SV=1 312 562 3.0E-23
sp|Q9CEK9|SYN_LACLA Asparagine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=asnS PE=3 SV=1 312 579 3.0E-23
sp|A4VTZ1|SYN_STRSY Asparagine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=asnS PE=3 SV=1 300 569 3.0E-23
sp|Q03L20|SYN_STRTD Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=asnS PE=3 SV=1 312 569 3.0E-23
sp|Q8DTM2|SYN_STRMU Asparagine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=asnS PE=3 SV=1 312 559 3.0E-23
sp|Q8U4D3|SYN_PYRFU Asparagine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=asnS PE=3 SV=2 313 548 3.0E-23
sp|Q02X21|SYN_LACLS Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=asnS PE=3 SV=1 312 579 3.0E-23
sp|A4J412|SYN_DESRM Asparagine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=asnS PE=3 SV=1 314 559 4.0E-23
sp|C5B9S7|SYD_EDWI9 Aspartate--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=aspS PE=3 SV=1 302 574 5.0E-23
sp|Q2KJG3|SYNC_BOVIN Asparagine--tRNA ligase, cytoplasmic OS=Bos taurus GN=NARS PE=2 SV=3 313 561 5.0E-23
sp|Q4R4Z1|SYNC_MACFA Asparagine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=NARS PE=2 SV=1 313 561 7.0E-23
sp|A2RMQ1|SYN_LACLM Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=asnS PE=3 SV=1 312 579 1.0E-22
sp|Q6BU46|SYNC_DEBHA Asparagine--tRNA ligase, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED81 PE=3 SV=1 312 561 1.0E-22
sp|O94567|SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrs1 PE=3 SV=1 321 561 2.0E-22
sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1 313 552 4.0E-22
sp|Q88WA8|SYN2_LACPL Asparagine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS2 PE=3 SV=1 304 613 7.0E-22
sp|A5D2C2|SYN_PELTS Asparagine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=asnS PE=3 SV=1 313 560 1.0E-21
sp|B9LCU8|SYN_CHLSY Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=asnS PE=3 SV=1 312 559 2.0E-21
sp|A9WA97|SYN_CHLAA Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=asnS PE=3 SV=1 312 559 2.0E-21
sp|A9GBR2|SYN_SORC5 Asparagine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=asnS PE=3 SV=1 312 568 2.0E-21
sp|Q8F522|SYN_LEPIN Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=asnS PE=3 SV=1 329 604 2.0E-21
sp|Q72QT4|SYN_LEPIC Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=asnS PE=3 SV=1 329 604 3.0E-21
sp|B7IE30|SYD_THEAB Aspartate--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=aspS PE=3 SV=1 302 557 4.0E-21
sp|Q1WU36|SYN_LACS1 Asparagine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=asnS PE=3 SV=1 324 615 4.0E-21
sp|Q081N5|SYD_SHEFN Aspartate--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aspS PE=3 SV=1 307 574 7.0E-21
sp|B8GBG7|SYN_CHLAD Asparagine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=asnS PE=3 SV=1 312 559 1.0E-20
sp|A3N5V6|SYDND_BURP6 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia pseudomallei (strain 668) GN=aspS PE=3 SV=1 312 559 3.0E-20
sp|Q050D9|SYN_LEPBL Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=asnS PE=3 SV=1 329 627 4.0E-20
sp|Q04SB3|SYN_LEPBJ Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=asnS PE=3 SV=1 329 627 4.0E-20
sp|Q0BBZ1|SYDND_BURCM Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=aspS PE=3 SV=1 312 559 4.0E-20
sp|B1JYI9|SYDND_BURCC Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=aspS PE=3 SV=1 312 559 4.0E-20
sp|B1YWF2|SYDND_BURA4 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia ambifaria (strain MC40-6) GN=aspS PE=3 SV=1 312 559 4.0E-20
sp|B4EBD1|SYDND_BURCJ Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=aspS PE=3 SV=1 312 559 4.0E-20
sp|Q2T132|SYDND_BURTA Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=aspS PE=3 SV=1 312 559 5.0E-20
sp|Q483C7|SYDND_COLP3 Aspartate--tRNA(Asp/Asn) ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=aspS PE=3 SV=1 305 559 6.0E-20
sp|Q39D20|SYDND_BURL3 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=aspS PE=3 SV=1 312 559 7.0E-20
sp|A9AYM5|SYN_HERA2 Asparagine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=asnS PE=3 SV=1 332 562 8.0E-20
sp|A0KAE8|SYDND_BURCH Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia cenocepacia (strain HI2424) GN=aspS PE=3 SV=1 312 559 1.0E-19
sp|Q1BTP1|SYDND_BURCA Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=aspS PE=3 SV=1 312 559 1.0E-19
sp|P38707|SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1 312 561 1.0E-19
sp|A5N1Y8|SYD_CLOK5 Aspartate--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=aspS PE=3 SV=1 307 559 1.0E-19
sp|B9E5P2|SYD_CLOK1 Aspartate--tRNA ligase OS=Clostridium kluyveri (strain NBRC 12016) GN=aspS PE=3 SV=1 307 559 1.0E-19
sp|A4JHR9|SYDND_BURVG Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=aspS PE=3 SV=1 312 559 1.0E-19
sp|Q63X93|SYDND_BURPS Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia pseudomallei (strain K96243) GN=aspS PE=3 SV=1 312 558 2.0E-19
sp|Q3JVY8|SYDND_BURP1 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia pseudomallei (strain 1710b) GN=aspS PE=3 SV=1 312 558 2.0E-19
sp|Q62MP0|SYDND_BURMA Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia mallei (strain ATCC 23344) GN=aspS PE=3 SV=2 312 558 2.0E-19
sp|A3NRK2|SYDND_BURP0 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia pseudomallei (strain 1106a) GN=aspS PE=3 SV=1 312 558 2.0E-19
sp|A1V745|SYDND_BURMS Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia mallei (strain SAVP1) GN=aspS PE=3 SV=1 312 558 2.0E-19
sp|A2S8L9|SYDND_BURM9 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia mallei (strain NCTC 10229) GN=aspS PE=3 SV=1 312 558 2.0E-19
sp|A3MNU6|SYDND_BURM7 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia mallei (strain NCTC 10247) GN=aspS PE=3 SV=1 312 558 2.0E-19
sp|Q0SRP8|SYD_CLOPS Aspartate--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=aspS PE=3 SV=1 312 558 2.0E-19
sp|Q7NG18|SYK_GLOVI Lysine--tRNA ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=lysS PE=3 SV=1 316 564 3.0E-19
sp|C4ZI12|SYD_EUBR3 Aspartate--tRNA ligase OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=aspS PE=3 SV=1 312 559 3.0E-19
sp|Q1IZA1|SYN_DEIGD Asparagine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=asnS PE=3 SV=1 312 534 4.0E-19
sp|B5XQ00|SYD_KLEP3 Aspartate--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=aspS PE=3 SV=1 305 532 4.0E-19
sp|B9DNF8|SYD_STACT Aspartate--tRNA ligase OS=Staphylococcus carnosus (strain TM300) GN=aspS PE=3 SV=1 312 574 4.0E-19
sp|Q1I6E5|SYDND_PSEE4 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas entomophila (strain L48) GN=aspS PE=3 SV=1 302 574 4.0E-19
sp|Q8XJ28|SYD_CLOPE Aspartate--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=aspS PE=3 SV=1 312 558 5.0E-19
sp|Q0TP28|SYD_CLOP1 Aspartate--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=aspS PE=3 SV=1 312 558 5.0E-19
sp|Q88NJ4|SYDND_PSEPK Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas putida (strain KT2440) GN=aspS PE=3 SV=1 302 574 6.0E-19
sp|A5VZU3|SYDND_PSEP1 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=aspS PE=3 SV=1 302 574 6.0E-19
sp|B2JCV5|SYDND_BURP8 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=aspS PE=3 SV=1 312 554 6.0E-19
sp|Q145N3|SYDND_BURXL Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia xenovorans (strain LB400) GN=aspS PE=3 SV=1 312 554 7.0E-19
sp|A7NHQ4|SYN_ROSCS Asparagine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=asnS PE=3 SV=1 313 559 7.0E-19
sp|A5UPW5|SYN_ROSS1 Asparagine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=asnS PE=3 SV=1 301 535 8.0E-19
sp|A9AFC7|SYDND_BURM1 Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=aspS PE=3 SV=1 312 559 8.0E-19
sp|B2FRP1|SYD_STRMK Aspartate--tRNA ligase OS=Stenotrophomonas maltophilia (strain K279a) GN=aspS PE=3 SV=1 307 574 8.0E-19
sp|C5BPP4|SYDND_TERTT Aspartate--tRNA(Asp/Asn) ligase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=aspS PE=3 SV=1 312 574 1.0E-18
sp|B0KTJ6|SYDND_PSEPG Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas putida (strain GB-1) GN=aspS PE=3 SV=1 302 574 1.0E-18
sp|B2S4M2|SYDND_TREPS Aspartate--tRNA(Asp/Asn) ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=aspS PE=3 SV=1 297 554 1.0E-18
sp|O83950|SYDND_TREPA Aspartate--tRNA(Asp/Asn) ligase OS=Treponema pallidum (strain Nichols) GN=aspS PE=3 SV=1 297 554 1.0E-18
sp|Q9RUN7|SYD_DEIRA Aspartate--tRNA(Asp) ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aspS1 PE=1 SV=1 316 559 1.0E-18
sp|B1JD74|SYDND_PSEPW Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas putida (strain W619) GN=aspS PE=3 SV=1 302 574 1.0E-18
sp|Q6D497|SYD_PECAS Aspartate--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aspS PE=3 SV=1 302 574 2.0E-18
sp|B4S8V2|SYDND_PROA2 Aspartate--tRNA(Asp/Asn) ligase OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=aspS PE=3 SV=1 331 553 2.0E-18
sp|C6DFE7|SYD_PECCP Aspartate--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aspS PE=3 SV=1 302 532 2.0E-18
sp|B5YR11|SYD_ECO5E Aspartate--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|C3KTB6|SYD_CLOB6 Aspartate--tRNA ligase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=aspS PE=3 SV=1 312 557 2.0E-18
sp|C1FKE5|SYD_CLOBJ Aspartate--tRNA ligase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=aspS PE=3 SV=1 312 557 2.0E-18
sp|Q322D4|SYD_SHIBS Aspartate--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B2TXL2|SYD_SHIB3 Aspartate--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B1LD05|SYD_ECOSM Aspartate--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B6IBU5|SYD_ECOSE Aspartate--tRNA ligase OS=Escherichia coli (strain SE11) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B7NBL7|SYD_ECOLU Aspartate--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B1J0M2|SYD_ECOLC Aspartate--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B7M2F7|SYD_ECO8A Aspartate--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B7L7R9|SYD_ECO55 Aspartate--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|A7ZMZ0|SYD_ECO24 Aspartate--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B7LPH8|SYD_ESCF3 Aspartate--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|A6TB35|SYD_KLEP7 Aspartate--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|Q0T3U0|SYD_SHIF8 Aspartate--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|Q28MH9|SYDND_JANSC Aspartate--tRNA(Asp/Asn) ligase OS=Jannaschia sp. (strain CCS1) GN=aspS PE=3 SV=1 296 571 2.0E-18
sp|B7NS52|SYD_ECO7I Aspartate--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|A4SPN5|SYD_AERS4 Aspartate--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=aspS PE=3 SV=1 305 532 2.0E-18
sp|Q7UAE6|SYD_SHIFL Aspartate--tRNA ligase OS=Shigella flexneri GN=aspS PE=3 SV=2 305 574 2.0E-18
sp|Q4L6X5|SYD_STAHJ Aspartate--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=aspS PE=3 SV=1 312 557 2.0E-18
sp|P21889|SYD_ECOLI Aspartate--tRNA ligase OS=Escherichia coli (strain K12) GN=aspS PE=1 SV=1 305 574 2.0E-18
sp|A8A166|SYD_ECOHS Aspartate--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B1XHD4|SYD_ECODH Aspartate--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|C4ZQF0|SYD_ECOBW Aspartate--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B7USP3|SYD_ECO27 Aspartate--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|Q8XCI7|SYD_ECO57 Aspartate--tRNA ligase OS=Escherichia coli O157:H7 GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|Q3Z2M4|SYD_SHISS Aspartate--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|Q1RAR8|SYD_ECOUT Aspartate--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|Q8FGQ9|SYD_ECOL6 Aspartate--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|Q0TGW6|SYD_ECOL5 Aspartate--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|A1AC27|SYD_ECOK1 Aspartate--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B7MVZ7|SYD_ECO81 Aspartate--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|B7MBS5|SYD_ECO45 Aspartate--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aspS PE=3 SV=1 305 574 2.0E-18
sp|A8AFH5|SYD_CITK8 Aspartate--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aspS PE=3 SV=1 305 532 2.0E-18
sp|Q8Y270|SYDND_RALSO Aspartate--tRNA(Asp/Asn) ligase OS=Ralstonia solanacearum (strain GMI1000) GN=aspS PE=3 SV=1 305 574 3.0E-18
sp|Q32H95|SYD_SHIDS Aspartate--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aspS PE=3 SV=1 305 574 3.0E-18
sp|C3JYT1|SYDND_PSEFS Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas fluorescens (strain SBW25) GN=aspS PE=3 SV=1 302 574 3.0E-18
sp|Q57N96|SYD_SALCH Aspartate--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=aspS PE=3 SV=1 305 574 3.0E-18
sp|Q97GU6|SYD_CLOAB Aspartate--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=aspS PE=3 SV=1 312 554 3.0E-18
sp|Q21YX2|SYDND_RHOFT Aspartate--tRNA(Asp/Asn) ligase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=aspS PE=3 SV=1 312 559 3.0E-18
sp|B5F3I9|SYD_SALA4 Aspartate--tRNA ligase OS=Salmonella agona (strain SL483) GN=aspS PE=3 SV=1 305 574 3.0E-18
sp|Q0VRK1|SYDND_ALCBS Aspartate--tRNA(Asp/Asn) ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=aspS PE=3 SV=1 313 574 4.0E-18
sp|A9MND2|SYD_SALAR Aspartate--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aspS PE=3 SV=1 305 574 4.0E-18
sp|Q2SJV9|SYN_HAHCH Asparagine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=asnS PE=3 SV=1 304 598 4.0E-18
sp|B4ETP3|SYD_PROMH Aspartate--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=aspS PE=3 SV=1 302 574 5.0E-18
sp|B8CNX7|SYD_SHEPW Aspartate--tRNA ligase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=aspS PE=3 SV=1 305 574 5.0E-18
sp|Q51422|SYDND_PSEAE Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aspS PE=1 SV=2 302 559 5.0E-18
sp|Q02IC5|SYDND_PSEAB Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=aspS PE=3 SV=1 302 559 5.0E-18
sp|B7UXW9|SYDND_PSEA8 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas aeruginosa (strain LESB58) GN=aspS PE=3 SV=1 302 559 5.0E-18
sp|A4G8X1|SYDND_HERAR Aspartate--tRNA(Asp/Asn) ligase OS=Herminiimonas arsenicoxydans GN=aspS PE=3 SV=1 334 559 6.0E-18
sp|B4ST40|SYD_STRM5 Aspartate--tRNA ligase OS=Stenotrophomonas maltophilia (strain R551-3) GN=aspS PE=3 SV=1 307 574 6.0E-18
sp|A4WBM3|SYD_ENT38 Aspartate--tRNA ligase OS=Enterobacter sp. (strain 638) GN=aspS PE=3 SV=1 305 532 6.0E-18
sp|Q8ZNV2|SYD_SALTY Aspartate--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|B4T7Z9|SYD_SALHS Aspartate--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|B5R8D6|SYD_SALG2 Aspartate--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|B5R1V2|SYD_SALEP Aspartate--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|B5FSN0|SYD_SALDC Aspartate--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|B1L096|SYD_CLOBM Aspartate--tRNA ligase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=aspS PE=3 SV=1 312 557 6.0E-18
sp|B5BH54|SYD_SALPK Aspartate--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|Q5PMZ6|SYD_SALPA Aspartate--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|Q8Z5W1|SYD_SALTI Aspartate--tRNA ligase OS=Salmonella typhi GN=aspS PE=3 SV=1 305 574 6.0E-18
sp|A9BP37|SYDND_DELAS Aspartate--tRNA(Asp/Asn) ligase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=aspS PE=3 SV=1 312 559 7.0E-18
sp|B4TYS4|SYD_SALSV Aspartate--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=aspS PE=3 SV=1 305 574 7.0E-18
sp|A9MUB9|SYD_SALPB Aspartate--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aspS PE=3 SV=1 305 574 7.0E-18
sp|B4SVF1|SYD_SALNS Aspartate--tRNA ligase OS=Salmonella newport (strain SL254) GN=aspS PE=3 SV=1 305 574 7.0E-18
sp|C0Q2E8|SYD_SALPC Aspartate--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=aspS PE=3 SV=1 305 574 7.0E-18
sp|Q554D9|SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=asnS1 PE=1 SV=1 330 626 8.0E-18
sp|B8I3F1|SYD_CLOCE Aspartate--tRNA ligase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=aspS PE=3 SV=1 305 558 8.0E-18
sp|Q87Y31|SYDND_PSESM Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=aspS PE=3 SV=1 302 574 9.0E-18
sp|B2VJ90|SYD_ERWT9 Aspartate--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aspS PE=3 SV=1 305 574 9.0E-18
sp|Q82SQ5|SYDND_NITEU Aspartate--tRNA(Asp/Asn) ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aspS PE=3 SV=1 334 559 1.0E-17
sp|Q0KEG8|SYDND_CUPNH Aspartate--tRNA(Asp/Asn) ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=aspS PE=3 SV=1 313 619 1.0E-17
sp|Q4ZWL5|SYDND_PSEU2 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=aspS PE=3 SV=1 302 559 1.0E-17
sp|Q5FKI4|SYD_LACAC Aspartate--tRNA ligase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=aspS PE=3 SV=1 302 558 1.0E-17
sp|A7GHS2|SYD_CLOBL Aspartate--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=aspS PE=3 SV=1 312 557 1.0E-17
sp|B1IMD7|SYD_CLOBK Aspartate--tRNA ligase OS=Clostridium botulinum (strain Okra / Type B1) GN=aspS PE=3 SV=1 312 557 1.0E-17
sp|Q2GLD8|SYDND_ANAPZ Aspartate--tRNA(Asp/Asn) ligase OS=Anaplasma phagocytophilum (strain HZ) GN=aspS PE=3 SV=1 296 551 1.0E-17
sp|Q48FC1|SYDND_PSE14 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=aspS PE=3 SV=1 302 559 1.0E-17
sp|Q12N06|SYD_SHEDO Aspartate--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aspS PE=3 SV=1 307 559 1.0E-17
sp|A5I6D5|SYD_CLOBH Aspartate--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=aspS PE=3 SV=1 312 557 1.0E-17
sp|A7FY03|SYD_CLOB1 Aspartate--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=aspS PE=3 SV=1 312 557 1.0E-17
sp|B3WEM2|SYD_LACCB Aspartate--tRNA ligase OS=Lactobacillus casei (strain BL23) GN=aspS PE=3 SV=1 315 532 1.0E-17
sp|Q038S1|SYD_LACC3 Aspartate--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=aspS PE=3 SV=1 315 532 1.0E-17
sp|A8H549|SYD_SHEPA Aspartate--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aspS PE=3 SV=1 307 559 1.0E-17
sp|Q9KDG1|SYD_BACHD Aspartate--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=aspS PE=3 SV=1 305 532 1.0E-17
sp|Q31H87|SYDND_THICR Aspartate--tRNA(Asp/Asn) ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=aspS PE=3 SV=1 305 559 1.0E-17
sp|Q8RAI7|SYDND_CALS4 Aspartate--tRNA(Asp/Asn) ligase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=aspS PE=3 SV=1 302 559 2.0E-17
sp|A4XRR7|SYDND_PSEMY Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas mendocina (strain ymp) GN=aspS PE=3 SV=1 302 574 2.0E-17
sp|A1TT99|SYDND_ACIAC Aspartate--tRNA(Asp/Asn) ligase OS=Acidovorax citrulli (strain AAC00-1) GN=aspS PE=3 SV=1 312 559 2.0E-17
sp|Q1LRG2|SYDND_CUPMC Aspartate--tRNA(Asp/Asn) ligase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=aspS PE=3 SV=1 312 576 2.0E-17
sp|Q7NRP0|SYDND_CHRVO Aspartate--tRNA(Asp/Asn) ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=aspS PE=3 SV=1 307 558 2.0E-17
sp|Q19722|SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=nrs-1 PE=3 SV=1 315 535 3.0E-17
sp|Q67P26|SYN_SYMTH Asparagine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=asnS PE=3 SV=1 303 534 3.0E-17
sp|C3LLL2|SYD_VIBCM Aspartate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=aspS PE=3 SV=1 305 532 3.0E-17
sp|Q9KSU0|SYD_VIBCH Aspartate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aspS PE=3 SV=1 305 532 3.0E-17
sp|A5F263|SYD_VIBC3 Aspartate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aspS PE=3 SV=1 305 532 3.0E-17
sp|B2AH15|SYDND_CUPTR Aspartate--tRNA(Asp/Asn) ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=aspS PE=3 SV=1 313 576 3.0E-17
sp|Q0AIE4|SYDND_NITEC Aspartate--tRNA(Asp/Asn) ligase OS=Nitrosomonas eutropha (strain C91) GN=aspS PE=3 SV=1 307 559 3.0E-17
sp|B0TSA3|SYD_SHEHH Aspartate--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aspS PE=3 SV=1 307 532 4.0E-17
sp|A4SF07|SYDND_CHLPM Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=aspS PE=3 SV=1 331 544 4.0E-17
sp|Q2FXU5|SYD_STAA8 Aspartate--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|P67016|SYD_STAAW Aspartate--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|A8Z2F7|SYD_STAAT Aspartate--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|Q6G8T9|SYD_STAAS Aspartate--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|P67015|SYD_STAAN Aspartate--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=aspS PE=1 SV=1 312 535 4.0E-17
sp|P67014|SYD_STAAM Aspartate--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|A6QHH2|SYD_STAAE Aspartate--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|Q5HFD3|SYD_STAAC Aspartate--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|Q2YT75|SYD_STAAB Aspartate--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|A5ITF4|SYD_STAA9 Aspartate--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|Q2FG97|SYD_STAA3 Aspartate--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|A6U298|SYD_STAA2 Aspartate--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|A7X344|SYD_STAA1 Aspartate--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|Q6GG73|SYD_STAAR Aspartate--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=aspS PE=3 SV=1 312 535 4.0E-17
sp|A7MEB6|SYD_CROS8 Aspartate--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aspS PE=3 SV=1 305 574 5.0E-17
sp|Q6F1A0|SYD_MESFL Aspartate--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=aspS PE=3 SV=1 305 557 5.0E-17
sp|C1DRG2|SYDND_AZOVD Aspartate--tRNA(Asp/Asn) ligase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=aspS PE=3 SV=1 302 574 6.0E-17
sp|B2SX42|SYDND_BURPP Aspartate--tRNA(Asp/Asn) ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=aspS PE=3 SV=1 312 554 6.0E-17
sp|Q5FG09|SYDND_EHRRG Aspartate--tRNA(Asp/Asn) ligase OS=Ehrlichia ruminantium (strain Gardel) GN=aspS PE=3 SV=1 296 551 6.0E-17
sp|A1S6P2|SYD_SHEAM Aspartate--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aspS PE=3 SV=1 305 574 6.0E-17
sp|Q5WWA3|SYDND_LEGPL Aspartate--tRNA(Asp/Asn) ligase OS=Legionella pneumophila (strain Lens) GN=aspS PE=3 SV=1 305 559 6.0E-17
sp|Q5X586|SYDND_LEGPA Aspartate--tRNA(Asp/Asn) ligase OS=Legionella pneumophila (strain Paris) GN=aspS PE=3 SV=1 305 559 6.0E-17
sp|C4L535|SYD_EXISA Aspartate--tRNA ligase OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=aspS PE=3 SV=1 312 574 6.0E-17
sp|A5IBW8|SYDND_LEGPC Aspartate--tRNA(Asp/Asn) ligase OS=Legionella pneumophila (strain Corby) GN=aspS PE=3 SV=1 305 559 7.0E-17
sp|Q5HAL5|SYDND_EHRRW Aspartate--tRNA(Asp/Asn) ligase OS=Ehrlichia ruminantium (strain Welgevonden) GN=aspS PE=3 SV=1 296 551 7.0E-17
sp|Q5ZVG2|SYDND_LEGPH Aspartate--tRNA(Asp/Asn) ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=aspS PE=3 SV=1 305 559 7.0E-17
sp|B4RPA1|SYDND_NEIG2 Aspartate--tRNA(Asp/Asn) ligase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=aspS PE=3 SV=1 302 559 7.0E-17
sp|B8GUK0|SYDND_THISH Aspartate--tRNA(Asp/Asn) ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=aspS PE=3 SV=1 307 574 8.0E-17
sp|A1RJQ6|SYD_SHESW Aspartate--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=aspS PE=3 SV=1 307 532 8.0E-17
sp|A4Y6S5|SYD_SHEPC Aspartate--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aspS PE=3 SV=1 307 532 9.0E-17
sp|C1CV26|SYN_DEIDV Asparagine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=asnS PE=3 SV=1 301 534 9.0E-17
sp|C1CV34|SYD_DEIDV Aspartate--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=aspS PE=3 SV=1 304 559 9.0E-17
sp|Q7MB41|SYD_PHOLL Aspartate--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aspS PE=3 SV=1 302 574 9.0E-17
sp|C5CCH2|SYDND_MICLC Aspartate--tRNA(Asp/Asn) ligase OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=aspS PE=3 SV=1 302 574 9.0E-17
sp|B1HV71|SYD_LYSSC Aspartate--tRNA ligase OS=Lysinibacillus sphaericus (strain C3-41) GN=aspS PE=3 SV=1 305 574 9.0E-17
sp|B2TN05|SYD_CLOBB Aspartate--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=aspS PE=3 SV=1 312 538 1.0E-16
sp|A2SEP2|SYDND_METPP Aspartate--tRNA(Asp/Asn) ligase OS=Methylibium petroleiphilum (strain PM1) GN=aspS PE=3 SV=1 307 587 1.0E-16
sp|Q3K7V6|SYDND_PSEPF Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas fluorescens (strain Pf0-1) GN=aspS PE=3 SV=1 302 574 1.0E-16
sp|Q5WHP3|SYD_BACSK Aspartate--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=aspS PE=3 SV=1 305 532 1.0E-16
sp|Q7W001|SYDND_BORPE Aspartate--tRNA(Asp/Asn) ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=aspS PE=3 SV=1 305 559 1.0E-16
sp|Q7W275|SYDND_BORPA Aspartate--tRNA(Asp/Asn) ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=aspS PE=3 SV=1 305 559 1.0E-16
sp|Q7WR42|SYDND_BORBR Aspartate--tRNA(Asp/Asn) ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=aspS PE=3 SV=1 305 559 1.0E-16
sp|A3QEP7|SYD_SHELP Aspartate--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aspS PE=3 SV=1 307 574 1.0E-16
sp|Q8EEE9|SYD_SHEON Aspartate--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=aspS PE=3 SV=1 307 559 1.0E-16
sp|A1AW56|SYDND_RUTMC Aspartate--tRNA(Asp/Asn) ligase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=aspS PE=3 SV=1 305 559 1.0E-16
sp|B1YJF7|SYD_EXIS2 Aspartate--tRNA ligase OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=aspS PE=3 SV=1 312 574 1.0E-16
sp|B1GZY6|SYDND_UNCTG Aspartate--tRNA(Asp/Asn) ligase OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=aspS PE=3 SV=1 312 559 1.0E-16
sp|Q1GIZ8|SYDND_RUEST Aspartate--tRNA(Asp/Asn) ligase OS=Ruegeria sp. (strain TM1040) GN=aspS PE=3 SV=1 296 576 1.0E-16
sp|Q88VQ8|SYD_LACPL Aspartate--tRNA ligase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=aspS PE=3 SV=1 307 532 2.0E-16
sp|B2V351|SYD_CLOBA Aspartate--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=aspS PE=3 SV=1 312 538 2.0E-16
sp|Q4K7D5|SYDND_PSEF5 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=aspS PE=3 SV=1 302 574 2.0E-16
sp|B3EQ26|SYDND_CHLPB Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium phaeobacteroides (strain BS1) GN=aspS PE=3 SV=1 331 551 2.0E-16
sp|A3D477|SYD_SHEB5 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aspS PE=3 SV=1 307 532 2.0E-16
sp|O94242|SYDM_SCHPO Aspartate--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msd1 PE=3 SV=1 310 550 2.0E-16
sp|Q5FQ60|SYDND_GLUOX Aspartate--tRNA(Asp/Asn) ligase OS=Gluconobacter oxydans (strain 621H) GN=aspS PE=3 SV=1 296 554 2.0E-16
sp|A9L3I1|SYD_SHEB9 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS195) GN=aspS PE=3 SV=1 307 532 2.0E-16
sp|A6WNQ6|SYD_SHEB8 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS185) GN=aspS PE=3 SV=1 307 532 2.0E-16
sp|B8EA71|SYD_SHEB2 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS223) GN=aspS PE=3 SV=1 307 532 2.0E-16
sp|A1JRL1|SYD_YERE8 Aspartate--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aspS PE=3 SV=1 305 532 2.0E-16
sp|Q8EPS0|SYD_OCEIH Aspartate--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=aspS PE=3 SV=1 305 559 2.0E-16
sp|Q5LUX6|SYDND_RUEPO Aspartate--tRNA(Asp/Asn) ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aspS PE=3 SV=1 296 554 2.0E-16
sp|A0KWL5|SYD_SHESA Aspartate--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=aspS PE=3 SV=1 307 532 2.0E-16
sp|Q3B3A1|SYDND_CHLL7 Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=aspS PE=3 SV=1 331 560 2.0E-16
sp|Q0HUY7|SYD_SHESR Aspartate--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=aspS PE=3 SV=1 307 532 2.0E-16
sp|A1B431|SYDND_PARDP Aspartate--tRNA(Asp/Asn) ligase OS=Paracoccus denitrificans (strain Pd 1222) GN=aspS PE=3 SV=1 302 535 3.0E-16
sp|Q317R3|SYDND_DESAG Aspartate--tRNA(Asp/Asn) ligase OS=Desulfovibrio alaskensis (strain G20) GN=aspS PE=3 SV=1 292 535 3.0E-16
sp|Q5E5P2|SYN_VIBF1 Asparagine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=asnS PE=3 SV=1 308 627 3.0E-16
sp|B4U7P3|SYDND_HYDS0 Aspartate--tRNA(Asp/Asn) ligase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=aspS PE=3 SV=1 312 542 3.0E-16
sp|A9M257|SYDND_NEIM0 Aspartate--tRNA(Asp/Asn) ligase OS=Neisseria meningitidis serogroup C (strain 053442) GN=aspS PE=3 SV=1 302 559 3.0E-16
sp|A0PZX0|SYD_CLONN Aspartate--tRNA ligase OS=Clostridium novyi (strain NT) GN=aspS PE=3 SV=1 305 557 3.0E-16
sp|Q21MA4|SYDND_SACD2 Aspartate--tRNA(Asp/Asn) ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aspS PE=3 SV=1 307 554 3.0E-16
sp|B0U2I5|SYD_XYLFM Aspartate--tRNA ligase OS=Xylella fastidiosa (strain M12) GN=aspS PE=3 SV=1 307 557 3.0E-16
sp|B2A2G0|SYDND_NATTJ Aspartate--tRNA(Asp/Asn) ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=aspS PE=3 SV=1 305 558 3.0E-16
sp|Q5QYV2|SYD_IDILO Aspartate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aspS PE=3 SV=1 302 559 3.0E-16
sp|A0RQ71|SYDND_CAMFF Aspartate--tRNA(Asp/Asn) ligase OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=aspS PE=3 SV=1 312 557 3.0E-16
sp|A1KAJ9|SYDND_AZOSB Aspartate--tRNA(Asp/Asn) ligase OS=Azoarcus sp. (strain BH72) GN=aspS PE=3 SV=1 334 574 3.0E-16
sp|A8FUW6|SYD_SHESH Aspartate--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=aspS PE=3 SV=1 307 532 4.0E-16
sp|Q8P6E0|SYD_XANCP Aspartate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=aspS PE=3 SV=1 307 574 4.0E-16
sp|Q4UXM5|SYD_XANC8 Aspartate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=aspS PE=3 SV=1 307 574 4.0E-16
sp|A8GFJ2|SYD_SERP5 Aspartate--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=aspS PE=3 SV=1 305 532 4.0E-16
sp|Q11JA7|SYDND_CHESB Aspartate--tRNA(Asp/Asn) ligase OS=Chelativorans sp. (strain BNC1) GN=aspS PE=3 SV=1 296 574 4.0E-16
sp|B6IN46|SYDND_RHOCS Aspartate--tRNA(Asp/Asn) ligase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=aspS PE=3 SV=1 296 535 4.0E-16
sp|B0RPX9|SYD_XANCB Aspartate--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain B100) GN=aspS PE=3 SV=1 307 574 4.0E-16
sp|Q3YRF1|SYDND_EHRCJ Aspartate--tRNA(Asp/Asn) ligase OS=Ehrlichia canis (strain Jake) GN=aspS PE=3 SV=1 296 551 4.0E-16
sp|Q2GHC9|SYDND_EHRCR Aspartate--tRNA(Asp/Asn) ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=aspS PE=3 SV=1 296 555 4.0E-16
sp|Q87CW0|SYD_XYLFT Aspartate--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=aspS PE=3 SV=1 307 557 4.0E-16
sp|B2I4Y5|SYD_XYLF2 Aspartate--tRNA ligase OS=Xylella fastidiosa (strain M23) GN=aspS PE=3 SV=1 307 557 4.0E-16
sp|Q3BQE6|SYD_XANC5 Aspartate--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=aspS PE=3 SV=1 307 574 5.0E-16
sp|Q475W2|SYDND_CUPPJ Aspartate--tRNA(Asp/Asn) ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=aspS PE=3 SV=1 313 576 5.0E-16
sp|Q49Y68|SYD_STAS1 Aspartate--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=aspS PE=3 SV=1 312 559 5.0E-16
sp|Q6NGZ4|SYDND_CORDI Aspartate--tRNA(Asp/Asn) ligase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=aspS PE=3 SV=1 296 535 5.0E-16
sp|Q5P280|SYDND_AROAE Aspartate--tRNA(Asp/Asn) ligase OS=Aromatoleum aromaticum (strain EbN1) GN=aspS PE=3 SV=1 302 574 5.0E-16
sp|B1KHG7|SYD_SHEWM Aspartate--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aspS PE=3 SV=1 307 574 6.0E-16
sp|Q0HIZ5|SYD_SHESM Aspartate--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=aspS PE=3 SV=1 307 532 6.0E-16
sp|C4LBN4|SYD_TOLAT Aspartate--tRNA ligase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=aspS PE=3 SV=1 316 532 6.0E-16
sp|Q4FMP8|SYDND_PELUB Aspartate--tRNA(Asp/Asn) ligase OS=Pelagibacter ubique (strain HTCC1062) GN=aspS PE=3 SV=1 296 551 6.0E-16
sp|A6VXD0|SYDND_MARMS Aspartate--tRNA(Asp/Asn) ligase OS=Marinomonas sp. (strain MWYL1) GN=aspS PE=3 SV=1 305 559 6.0E-16
sp|A1KVG2|SYDND_NEIMF Aspartate--tRNA(Asp/Asn) ligase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=aspS PE=3 SV=1 302 559 6.0E-16
sp|Q16B16|SYDND_ROSDO Aspartate--tRNA(Asp/Asn) ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=aspS PE=3 SV=1 296 576 7.0E-16
sp|Q38XB6|SYD_LACSS Aspartate--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=aspS PE=3 SV=1 307 532 7.0E-16
sp|Q8PHU5|SYD_XANAC Aspartate--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=aspS PE=3 SV=1 307 570 7.0E-16
sp|C1DB91|SYDND_LARHH Aspartate--tRNA(Asp/Asn) ligase OS=Laribacter hongkongensis (strain HLHK9) GN=aspS PE=3 SV=1 312 559 7.0E-16
sp|A0QI91|SYDND_MYCA1 Aspartate--tRNA(Asp/Asn) ligase OS=Mycobacterium avium (strain 104) GN=aspS PE=3 SV=1 313 557 7.0E-16
sp|Q4JVF2|SYDND_CORJK Aspartate--tRNA(Asp/Asn) ligase OS=Corynebacterium jeikeium (strain K411) GN=aspS PE=3 SV=1 312 557 8.0E-16
sp|Q9JT23|SYDND_NEIMA Aspartate--tRNA(Asp/Asn) ligase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=aspS PE=3 SV=1 302 558 8.0E-16
sp|Q15RN2|SYDND_PSEA6 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aspS PE=3 SV=1 302 574 8.0E-16
sp|B3EDE5|SYDND_CHLL2 Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=aspS PE=3 SV=1 331 544 8.0E-16
sp|B1JLL5|SYD_YERPY Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|Q66AU4|SYD_YERPS Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|A4TJK5|SYD_YERPP Aspartate--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|Q1CJH0|SYD_YERPN Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|A9QYX8|SYD_YERPG Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|Q8ZEV0|SYD_YERPE Aspartate--tRNA ligase OS=Yersinia pestis GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|B2K319|SYD_YERPB Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|Q1C820|SYD_YERPA Aspartate--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|A7FID0|SYD_YERP3 Aspartate--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|C0MGD3|SYD_STRS7 Aspartate--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=aspS PE=3 SV=1 312 571 8.0E-16
sp|A2RGY0|SYD_STRPG Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=aspS PE=3 SV=1 312 553 8.0E-16
sp|Q87QV2|SYD_VIBPA Aspartate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aspS PE=3 SV=1 305 532 8.0E-16
sp|Q892B2|SYD_CLOTE Aspartate--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=aspS PE=3 SV=1 305 558 8.0E-16
sp|C0MB16|SYD_STRE4 Aspartate--tRNA ligase OS=Streptococcus equi subsp. equi (strain 4047) GN=aspS PE=3 SV=1 312 571 8.0E-16
sp|Q9K0U5|SYDND_NEIMB Aspartate--tRNA(Asp/Asn) ligase OS=Neisseria meningitidis serogroup B (strain MC58) GN=aspS PE=3 SV=1 302 559 9.0E-16
sp|B2STK7|SYD_XANOP Aspartate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=aspS PE=3 SV=1 307 574 1.0E-15
sp|Q1IZB4|SYD_DEIGD Aspartate--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=aspS PE=3 SV=1 304 559 1.0E-15
sp|A6LTP1|SYD_CLOB8 Aspartate--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=aspS PE=3 SV=1 312 535 1.0E-15
sp|B3PB55|SYDND_CELJU Aspartate--tRNA(Asp/Asn) ligase OS=Cellvibrio japonicus (strain Ueda107) GN=aspS PE=3 SV=1 307 567 1.0E-15
sp|P0DG31|SYD_STRPQ Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=aspS PE=3 SV=1 312 553 1.0E-15
sp|P0DG30|SYD_STRP3 Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=aspS PE=3 SV=1 312 553 1.0E-15
sp|Q7MJS0|SYN_VIBVY Asparagine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=asnS PE=3 SV=1 309 599 1.0E-15
sp|Q8DAF0|SYN_VIBVU Asparagine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=asnS PE=3 SV=1 309 599 1.0E-15
sp|Q5H2B1|SYD_XANOR Aspartate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=aspS PE=3 SV=2 307 574 1.0E-15
sp|Q2P582|SYD_XANOM Aspartate--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=aspS PE=3 SV=1 307 574 1.0E-15
sp|Q9PCC5|SYD_XYLFA Aspartate--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=aspS PE=3 SV=1 307 557 1.0E-15
sp|Q99XL0|SYD_STRP1 Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=aspS PE=3 SV=1 312 553 1.0E-15
sp|C3M9G8|SYDND_RHISN Aspartate--tRNA(Asp/Asn) ligase OS=Rhizobium sp. (strain NGR234) GN=aspS PE=3 SV=1 296 573 1.0E-15
sp|B4U0K5|SYD_STREM Aspartate--tRNA ligase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=aspS PE=3 SV=1 312 571 1.0E-15
sp|C1KVG6|SYD_LISMC Aspartate--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=aspS PE=3 SV=1 305 532 1.0E-15
sp|A4J2J2|SYDND_DESRM Aspartate--tRNA(Asp/Asn) ligase OS=Desulfotomaculum reducens (strain MI-1) GN=aspS PE=3 SV=1 305 535 1.0E-15
sp|B5XJ82|SYD_STRPZ Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=aspS PE=3 SV=1 312 553 1.0E-15
sp|Q8NZ20|SYD_STRP8 Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=aspS PE=3 SV=1 312 553 1.0E-15
sp|B8DHM9|SYD_LISMH Aspartate--tRNA ligase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=aspS PE=3 SV=1 305 532 1.0E-15
sp|B8JH60|SYDND_ANAD2 Aspartate--tRNA(Asp/Asn) ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=aspS PE=3 SV=1 302 574 1.0E-15
sp|Q48QS8|SYD_STRPM Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=aspS PE=3 SV=2 312 553 1.0E-15
sp|A1WHI6|SYDND_VEREI Aspartate--tRNA(Asp/Asn) ligase OS=Verminephrobacter eiseniae (strain EF01-2) GN=aspS PE=3 SV=1 307 558 1.0E-15
sp|Q5X9E6|SYD_STRP6 Aspartate--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=aspS PE=3 SV=2 312 553 1.0E-15
sp|Q3IIN7|SYD_PSEHT Aspartate--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aspS PE=3 SV=1 305 532 1.0E-15
sp|A9N999|SYDND_COXBR Aspartate--tRNA(Asp/Asn) ligase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=aspS PE=3 SV=1 331 561 1.0E-15
sp|A7N1J1|SYD_VIBCB Aspartate--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aspS PE=3 SV=1 305 532 1.0E-15
sp|A9KF44|SYDND_COXBN Aspartate--tRNA(Asp/Asn) ligase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=aspS PE=3 SV=1 331 561 1.0E-15
sp|Q71ZF1|SYD_LISMF Aspartate--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=aspS PE=3 SV=1 305 532 1.0E-15
sp|Q83BE5|SYDND_COXBU Aspartate--tRNA(Asp/Asn) ligase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=aspS PE=3 SV=1 331 561 1.0E-15
sp|Q2YBG1|SYDND_NITMU Aspartate--tRNA(Asp/Asn) ligase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=aspS PE=3 SV=1 334 557 1.0E-15
sp|Q03IB4|SYD_STRTD Aspartate--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=aspS PE=3 SV=1 312 553 1.0E-15
sp|B5ZX21|SYDND_RHILW Aspartate--tRNA(Asp/Asn) ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=aspS PE=3 SV=1 296 571 1.0E-15
sp|P54263|SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=asnS PE=1 SV=2 314 535 1.0E-15
sp|Q2NTJ3|SYD_SODGM Aspartate--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=aspS PE=3 SV=1 305 532 2.0E-15
sp|B7GFR1|SYDND_ANOFW Aspartate--tRNA(Asp/Asn) ligase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=aspS PE=3 SV=1 302 532 2.0E-15
sp|Q55FI3|SYNM_DICDI Probable asparagine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=asnS2 PE=3 SV=1 294 603 2.0E-15
sp|Q607I4|SYDND_METCA Aspartate--tRNA(Asp/Asn) ligase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=aspS PE=3 SV=1 305 574 2.0E-15
sp|Q5LXN1|SYD_STRT1 Aspartate--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=aspS PE=3 SV=1 312 553 2.0E-15
sp|Q8Y709|SYD_LISMO Aspartate--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=aspS PE=3 SV=1 305 532 2.0E-15
sp|Q72KF7|SYN_THET2 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=asnS PE=3 SV=1 314 535 2.0E-15
sp|B8F789|SYD_HAEPS Aspartate--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=aspS PE=3 SV=1 307 532 2.0E-15
sp|A1W4E1|SYDND_ACISJ Aspartate--tRNA(Asp/Asn) ligase OS=Acidovorax sp. (strain JS42) GN=aspS PE=3 SV=1 312 558 2.0E-15
sp|B9ME28|SYDND_ACIET Aspartate--tRNA(Asp/Asn) ligase OS=Acidovorax ebreus (strain TPSY) GN=aspS PE=3 SV=1 312 558 2.0E-15
sp|A1BGZ4|SYDND_CHLPD Aspartate--tRNA(Asp/Asn) ligase OS=Chlorobium phaeobacteroides (strain DSM 266) GN=aspS PE=3 SV=1 331 568 2.0E-15
sp|Q7NJA4|SYDND_GLOVI Aspartate--tRNA(Asp/Asn) ligase OS=Gloeobacter violaceus (strain PCC 7421) GN=aspS PE=3 SV=1 312 535 2.0E-15
sp|Q5M283|SYD_STRT2 Aspartate--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=aspS PE=3 SV=1 312 553 2.0E-15
sp|A7NFC6|SYK_ROSCS Lysine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=lysS PE=3 SV=1 313 564 2.0E-15
sp|Q741M7|SYDND_MYCPA Aspartate--tRNA(Asp/Asn) ligase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=aspS PE=3 SV=1 313 557 2.0E-15
sp|B4UIE3|SYDND_ANASK Aspartate--tRNA(Asp/Asn) ligase OS=Anaeromyxobacter sp. (strain K) GN=aspS PE=3 SV=1 302 574 2.0E-15
sp|Q2IKX7|SYDND_ANADE Aspartate--tRNA(Asp/Asn) ligase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=aspS PE=3 SV=1 302 574 3.0E-15
sp|Q0AYS1|SYDND_SYNWW Aspartate--tRNA(Asp/Asn) ligase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=aspS PE=3 SV=1 305 554 3.0E-15
sp|Q8DG51|SYN_THEEB Asparagine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=asnS PE=3 SV=1 307 562 3.0E-15
sp|Q39VY3|SYDND_GEOMG Aspartate--tRNA(Asp/Asn) ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=aspS PE=3 SV=1 365 554 3.0E-15
sp|Q6LPQ6|SYN_PHOPR Asparagine--tRNA ligase OS=Photobacterium profundum GN=asnS PE=3 SV=1 308 627 3.0E-15
sp|Q47IE0|SYDND_DECAR Aspartate--tRNA(Asp/Asn) ligase OS=Dechloromonas aromatica (strain RCB) GN=aspS PE=3 SV=1 302 574 3.0E-15
sp|Q03F52|SYD_PEDPA Aspartate--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=aspS PE=3 SV=1 307 532 4.0E-15
sp|Q3JEB6|SYDND_NITOC Aspartate--tRNA(Asp/Asn) ligase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=aspS PE=3 SV=1 302 561 4.0E-15
sp|Q5NIQ4|SYDND_FRATT Aspartate--tRNA(Asp/Asn) ligase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=aspS PE=3 SV=2 305 532 4.0E-15
sp|B5YJP5|SYDND_THEYD Aspartate--tRNA(Asp/Asn) ligase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=aspS PE=3 SV=1 305 559 4.0E-15
sp|Q2LTE0|SYDN2_SYNAS Aspartate--tRNA(Asp/Asn) ligase 2 OS=Syntrophus aciditrophicus (strain SB) GN=aspS2 PE=3 SV=1 305 559 4.0E-15
sp|B1XWR8|SYDND_LEPCP Aspartate--tRNA(Asp/Asn) ligase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=aspS PE=3 SV=1 305 554 4.0E-15
sp|A1SST6|SYDND_PSYIN Aspartate--tRNA(Asp/Asn) ligase OS=Psychromonas ingrahamii (strain 37) GN=aspS PE=3 SV=1 305 574 5.0E-15
sp|A4J0C7|SYDND_FRATW Aspartate--tRNA(Asp/Asn) ligase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=aspS PE=3 SV=1 305 532 5.0E-15
sp|B5Z6Y8|SYDND_HELPG Aspartate--tRNA(Asp/Asn) ligase OS=Helicobacter pylori (strain G27) GN=aspS PE=3 SV=1 419 574 5.0E-15
sp|Q2RHW1|SYDND_MOOTA Aspartate--tRNA(Asp/Asn) ligase OS=Moorella thermoacetica (strain ATCC 39073) GN=aspS PE=3 SV=1 313 558 5.0E-15
sp|A0LUJ6|SYDND_ACIC1 Aspartate--tRNA(Asp/Asn) ligase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=aspS PE=3 SV=1 313 574 5.0E-15
sp|A8LI32|SYDND_DINSH Aspartate--tRNA(Asp/Asn) ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=aspS PE=3 SV=1 296 554 5.0E-15
sp|Q6ANL4|SYN_DESPS Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=asnS PE=3 SV=1 359 559 5.0E-15
sp|Q8DAN7|SYD_VIBVU Aspartate--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=aspS PE=3 SV=1 305 532 5.0E-15
sp|Q7MJ74|SYD_VIBVY Aspartate--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=aspS PE=3 SV=1 305 532 5.0E-15
sp|B0K0N5|SYDND_THEPX Aspartate--tRNA(Asp/Asn) ligase OS=Thermoanaerobacter sp. (strain X514) GN=aspS PE=3 SV=1 331 548 5.0E-15
sp|Q0BPA2|SYDND_FRATO Aspartate--tRNA(Asp/Asn) ligase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=aspS PE=3 SV=1 305 532 5.0E-15
sp|Q2A622|SYDND_FRATH Aspartate--tRNA(Asp/Asn) ligase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=aspS PE=3 SV=1 305 532 5.0E-15
sp|A7N949|SYDND_FRATF Aspartate--tRNA(Asp/Asn) ligase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=aspS PE=3 SV=1 305 532 5.0E-15
sp|Q6LT53|SYD_PHOPR Aspartate--tRNA ligase OS=Photobacterium profundum GN=aspS PE=3 SV=1 305 532 6.0E-15
sp|Q4FSF4|SYDND_PSYA2 Aspartate--tRNA(Asp/Asn) ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=aspS PE=3 SV=1 334 559 6.0E-15
sp|Q983E9|SYDND_RHILO Aspartate--tRNA(Asp/Asn) ligase OS=Rhizobium loti (strain MAFF303099) GN=aspS PE=3 SV=1 296 573 6.0E-15
sp|Q2W3D5|SYDND_MAGSA Aspartate--tRNA(Asp/Asn) ligase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=aspS PE=3 SV=1 166 554 6.0E-15
sp|Q3A5R7|SYDND_PELCD Aspartate--tRNA(Asp/Asn) ligase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=aspS PE=3 SV=1 361 558 6.0E-15
sp|B0BQ90|SYD_ACTPJ Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=aspS PE=3 SV=1 307 532 6.0E-15
sp|A3N1F3|SYD_ACTP2 Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aspS PE=3 SV=1 307 532 6.0E-15
sp|B3GY37|SYD_ACTP7 Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aspS PE=3 SV=1 307 532 6.0E-15
sp|C5CWX8|SYDND_VARPS Aspartate--tRNA(Asp/Asn) ligase OS=Variovorax paradoxus (strain S110) GN=aspS PE=3 SV=1 312 561 6.0E-15
sp|Q5GTS0|SYDND_WOLTR Aspartate--tRNA(Asp/Asn) ligase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=aspS PE=3 SV=2 296 555 6.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0044281 small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5215
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1911 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7304
Ophiocordyceps camponoti-floridani Ophcf2|04224
Ophiocordyceps camponoti-rufipedis Ophun1|6629
Ophiocordyceps kimflemingae Ophio5|2388
Ophiocordyceps subramaniannii Hirsu2|4170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1911
MPARSGLLASAIGGLPIIRSRSKRRDASNSSSPAPSKTTTANKKENGHTTRSTTPAPTPPTPPTPTLSDAAPNTS
ASDKPTAVTKSASLRQKKTIASPRAQSTPASPRPADAISDGIADGNVTSTPIAAHAAAAPQHSQSRGLDSDATKP
TAASLQPPRPPSAPPSTSPLPPPPALAAVTPPQGRPRRHPSTRSRPLSLVSVTSASNPRSGPSSAFGGGCGTNSA
RNSLLLSSDSSVANMPPANAQLLPQHPRKVPPATTATADSGVELARCSLDVDRSTTSFDSNRTGTSADWPMHPSE
LNTISQLNQLPLGSQVTFRARISTQRQLSKALDFLLFRDQTYSVQGVLSRDEMDMVQWVNKLHPESLVQVSGTLK
APPEPVRSATHSGIEVHVHSIHLVTAASNAPFSNYKPPETLRNRLATRILDLRHPSNQALFRIRSLVSRLFRETL
EQQGFMEINTPKLQPAATESGAAVFKVNYFGRNAFLAQSPQLAKQSAVSADFGRVFEIGPVFRAENSNTHRHLTE
YTGLDLEMAIEHDYHEVIDVIDVFLKAVFAAVLDSPEIAEVRKRWPSDEFKYLDETLILDFREGIRMLREDGRDV
AEEDLSTPDEMRLGQLRTPLLHAQGPRRRRLDAVV*
Coding >OphauG2|1911
ATGCCAGCGAGAAGCGGCCTCCTGGCTTCTGCCATTGGCGGCTTGCCCATTATTCGAAGCCGCTCCAAACGTCGA
GACGCCAGCAACTCGTCCAGCCCCGCTCCGTCCAAGACGACGACGGCTAACAAGAAGGAAAATGGCCACACCACC
AGGTCGACAACGCCAGCGCCCACTCCGCCAACGCCACCAACGCCTACGCTGTCAGATGCGGCTCCCAACACGTCG
GCTTCCGACAAGCCCACCGCCGTCACAAAGTCTGCGTCGCTCAGGCAGAAAAAGACAATTGCCTCGCCCAGGGCC
CAGTCGACCCCTGCGTCGCCTCGTCCTGCTGACGCCATCTCTGACGGCATCGCTGACGGCAACGTCACATCGACG
CCCATCGCGGCCCATGCCGCTGCCGCCCCCCAACACTCCCAATCCCGCGGCCTGGACTCGGACGCTACAAAACCT
ACAGCCGCTTCCCTACAGCCGCCTCGCCCCCCTTCTGCTCCCCCGTCAACCTCGCCCCTCCCCCCTCCCCCTGCC
CTTGCGGCTGTCACTCCCCCCCAAGGCCGCCCTCGACGTCACCCCAGCACCCGCTCCCGCCCCCTCTCCCTCGTA
TCCGTCACGTCGGCGTCGAACCCGCGAAGCGGCCCCAGCAGCGCGTTTGGCGGCGGCTGTGGCACCAACAGTGCT
AGAAACAGTCTCTTGCTCTCGAGCGACAGCAGCGTCGCCAATATGCCCCCAGCCAACGCCCAGCTGCTCCCACAG
CACCCGCGCAAAGTGCCGCCCGCCACCACCGCGACGGCGGACAGCGGCGTCGAGCTGGCGCGATGCAGCCTCGAC
GTCGACCGCTCCACCACGTCGTTTGACAGCAACCGCACCGGCACCAGCGCCGACTGGCCCATGCACCCCTCGGAG
CTCAACACGATTTCCCAGCTCAACCAGCTGCCCCTGGGCTCCCAGGTGACGTTTCGCGCGCGCATCTCCACGCAG
CGCCAATTGTCCAAGGCGCTCGACTTTTTGCTCTTCCGCGACCAGACCTACTCGGTCCAGGGCGTCTTGTCGCGC
GACGAGATGGACATGGTGCAATGGGTCAACAAGCTCCATCCCGAGTCCCTGGTGCAGGTCAGCGGCACCCTCAAG
GCGCCTCCCGAGCCTGTCCGGTCGGCCACGCACTCGGGCATCGAGGTGCACGTGCACTCGATCCACCTGGTGACG
GCGGCGAGCAATGCGCCCTTTTCCAACTACAAGCCGCCCGAGACGCTTCGCAACCGGCTGGCCACGCGCATCCTG
GACCTGCGGCACCCTTCCAACCAGGCCTTGTTCCGCATCCGGTCGCTGGTGTCGCGGCTGTTCCGCGAGACGCTG
GAGCAGCAGGGCTTCATGGAGATCAACACGCCCAAGCTGCAGCCGGCGGCGACGGAGAGCGGGGCTGCCGTGTTC
AAGGTTAACTACTTTGGGCGCAACGCCTTTTTGGCGCAGAGCCCGCAGCTGGCCAAGCAGTCGGCCGTGTCGGCC
GACTTTGGGCGCGTGTTTGAAATCGGCCCCGTGTTCCGCGCGGAAAACTCCAACACGCACCGCCACTTGACCGAG
TACACGGGGCTGGACCTGGAAATGGCGATTGAGCACGACTACCACGAGGTGATTGACGTGATTGACGTGTTTCTC
AAGGCGGTGTTTGCGGCGGTGCTGGACTCGCCCGAGATTGCCGAGGTGCGCAAGCGGTGGCCCAGCGACGAGTTC
AAGTATCTCGACGAGACGCTGATTCTGGACTTCCGCGAGGGCATCCGCATGCTGCGCGAGGACGGGCGCGACGTG
GCCGAGGAGGACCTGTCGACGCCCGACGAGATGCGCCTGGGGCAGCTGCGCACGCCCCTTTTACACGCACAAGGA
CCCCGACGACGGCGACTGGACGCGGTCGTTTGA
Transcript >OphauG2|1911
ATGCCAGCGAGAAGCGGCCTCCTGGCTTCTGCCATTGGCGGCTTGCCCATTATTCGAAGCCGCTCCAAACGTCGA
GACGCCAGCAACTCGTCCAGCCCCGCTCCGTCCAAGACGACGACGGCTAACAAGAAGGAAAATGGCCACACCACC
AGGTCGACAACGCCAGCGCCCACTCCGCCAACGCCACCAACGCCTACGCTGTCAGATGCGGCTCCCAACACGTCG
GCTTCCGACAAGCCCACCGCCGTCACAAAGTCTGCGTCGCTCAGGCAGAAAAAGACAATTGCCTCGCCCAGGGCC
CAGTCGACCCCTGCGTCGCCTCGTCCTGCTGACGCCATCTCTGACGGCATCGCTGACGGCAACGTCACATCGACG
CCCATCGCGGCCCATGCCGCTGCCGCCCCCCAACACTCCCAATCCCGCGGCCTGGACTCGGACGCTACAAAACCT
ACAGCCGCTTCCCTACAGCCGCCTCGCCCCCCTTCTGCTCCCCCGTCAACCTCGCCCCTCCCCCCTCCCCCTGCC
CTTGCGGCTGTCACTCCCCCCCAAGGCCGCCCTCGACGTCACCCCAGCACCCGCTCCCGCCCCCTCTCCCTCGTA
TCCGTCACGTCGGCGTCGAACCCGCGAAGCGGCCCCAGCAGCGCGTTTGGCGGCGGCTGTGGCACCAACAGTGCT
AGAAACAGTCTCTTGCTCTCGAGCGACAGCAGCGTCGCCAATATGCCCCCAGCCAACGCCCAGCTGCTCCCACAG
CACCCGCGCAAAGTGCCGCCCGCCACCACCGCGACGGCGGACAGCGGCGTCGAGCTGGCGCGATGCAGCCTCGAC
GTCGACCGCTCCACCACGTCGTTTGACAGCAACCGCACCGGCACCAGCGCCGACTGGCCCATGCACCCCTCGGAG
CTCAACACGATTTCCCAGCTCAACCAGCTGCCCCTGGGCTCCCAGGTGACGTTTCGCGCGCGCATCTCCACGCAG
CGCCAATTGTCCAAGGCGCTCGACTTTTTGCTCTTCCGCGACCAGACCTACTCGGTCCAGGGCGTCTTGTCGCGC
GACGAGATGGACATGGTGCAATGGGTCAACAAGCTCCATCCCGAGTCCCTGGTGCAGGTCAGCGGCACCCTCAAG
GCGCCTCCCGAGCCTGTCCGGTCGGCCACGCACTCGGGCATCGAGGTGCACGTGCACTCGATCCACCTGGTGACG
GCGGCGAGCAATGCGCCCTTTTCCAACTACAAGCCGCCCGAGACGCTTCGCAACCGGCTGGCCACGCGCATCCTG
GACCTGCGGCACCCTTCCAACCAGGCCTTGTTCCGCATCCGGTCGCTGGTGTCGCGGCTGTTCCGCGAGACGCTG
GAGCAGCAGGGCTTCATGGAGATCAACACGCCCAAGCTGCAGCCGGCGGCGACGGAGAGCGGGGCTGCCGTGTTC
AAGGTTAACTACTTTGGGCGCAACGCCTTTTTGGCGCAGAGCCCGCAGCTGGCCAAGCAGTCGGCCGTGTCGGCC
GACTTTGGGCGCGTGTTTGAAATCGGCCCCGTGTTCCGCGCGGAAAACTCCAACACGCACCGCCACTTGACCGAG
TACACGGGGCTGGACCTGGAAATGGCGATTGAGCACGACTACCACGAGGTGATTGACGTGATTGACGTGTTTCTC
AAGGCGGTGTTTGCGGCGGTGCTGGACTCGCCCGAGATTGCCGAGGTGCGCAAGCGGTGGCCCAGCGACGAGTTC
AAGTATCTCGACGAGACGCTGATTCTGGACTTCCGCGAGGGCATCCGCATGCTGCGCGAGGACGGGCGCGACGTG
GCCGAGGAGGACCTGTCGACGCCCGACGAGATGCGCCTGGGGCAGCTGCGCACGCCCCTTTTACACGCACAAGGA
CCCCGACGACGGCGACTGGACGCGGTCGTTTGA
Gene >OphauG2|1911
ATGCCAGCGAGAAGCGGCCTCCTGGCTTCTGCCATTGGCGGCTTGCCCATTATTCGAAGCCGCTCCAAACGTCGA
GACGCCAGCAACTCGTCCAGCCCCGCTCCGTCCAAGACGACGACGGCTAACAAGAAGGAAAATGGCCACACCACC
AGGTCGACAACGCCAGCGCCCACTCCGCCAACGCCACCAACGCCTACGCTGTCAGATGCGGCTCCCAACACGTCG
GCTTCCGACAAGCCCACCGCCGTCACAAAGTCTGCGTCGCTCAGGCAGAAAAAGACAATTGCCTCGCCCAGGGCC
CAGTCGACCCCTGCGTCGCCTCGTCCTGCTGACGCCATCTCTGACGGCATCGCTGACGGCAACGTCACATCGACG
CCCATCGCGGCCCATGCCGCTGCCGCCCCCCAACACTCCCAATCCCGCGGCCTGGACTCGGACGCTACAAAACCT
ACAGCCGCTTCCCTACAGCCGCCTCGCCCCCCTTCTGCTCCCCCGTCAACCTCGCCCCTCCCCCCTCCCCCTGCC
CTTGCGGCTGTCACTCCCCCCCAAGGCCGCCCTCGACGTCACCCCAGCACCCGCTCCCGCCCCCTCTCCCTCGTA
TCCGTCACGTCGGCGTCGAACCCGCGAAGCGGCCCCAGCAGCGCGTTTGGCGGCGGCTGTGGCACCAACAGTGCT
AGAAACAGTCTCTTGCTCTCGAGCGACAGCAGCGTCGCCAATATGCCCCCAGCCAACGCCCAGCTGCTCCCACAG
CACCCGCGCAAAGTGCCGCCCGCCACCACCGCGACGGCGGACAGCGGCGTCGAGCTGGCGCGATGCAGCCTCGAC
GTCGACCGCTCCACCACGTCGTTTGACAGCAACCGCACCGGCACCAGCGCCGACTGGCCCATGCACCCCTCGGAG
CTCAACACGATTTCCCAGCTCAACCAGCTGCCCCTGGGCTCCCAGGTGACGTTTCGCGCGCGCATCTCCACGCAG
CGCCAATTGTCCAAGGCGCTCGACTTTTTGCTCTTCCGCGACCAGACCTACTCGGTCCAGGGCGTCTTGTCGCGC
GACGAGATGGACATGGTGCAATGGGTCAACAAGCTCCATCCCGAGTCCCTGGTGCAGGTCAGCGGCACCCTCAAG
GCGCCTCCCGAGCCTGTCCGGTCGGCCACGCACTCGGGCATCGAGGTGCACGTGCACTCGATCCACCTGGTGACG
GCGGCGAGCAATGCGCCCTTTTCCAACTACAAGCCGCCCGAGACGCTTCGCAACCGGCTGGCCACGCGCATCCTG
GACCTGCGGCACCCTTCCAACCAGGCCTTGTTCCGCATCCGGTCGCTGGTGTCGCGGCTGTTCCGCGAGACGCTG
GAGCAGCAGGGCTTCATGGAGATCAACACGCCCAAGCTGCAGCCGGCGGCGACGGAGAGCGGGGCTGCCGTGTTC
AAGGTTAACTACTTTGGGCGCAACGCCTTTTTGGCGCAGAGCCCGCAGCTGGCCAAGCAGTCGGCCGTGTCGGCC
GACTTTGGGCGCGTGTTTGAAATCGGCCCCGTGTTCCGCGCGGAAAACTCCAACACGCACCGCCACTTGACCGAG
TACACGGGGCTGGACCTGGAAATGGCGATTGAGCACGACTACCACGAGGTGATTGACGTGATTGACGTGTTTCTC
AAGGCGGTGTTTGCGGCGGTGCTGGACTCGCCCGAGATTGCCGAGGTGCGCAAGCGGTGGCCCAGCGACGAGTTC
AAGTATCTCGACGAGACGCTGATTCTGGACTTCCGCGAGGGCATCCGCATGCTGCGCGAGGACGGGCGCGACGTG
GCCGAGGAGGACCTGTCGACGCCCGACGAGATGCGCCTGGGGCAGCTGGTGCGCGAGAAATACGGCACCGACTAC
TACGTGCTGGACAAGTTCCCCGCCAGCGCACGCCCCTTTTACACGCACAAGGACCCCGACGACGGCGACTGGACG
CGGTCGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail