Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1910
Gene name
LocationContig_1617:1373..2824
Strand-
Gene length (bp)1451
Transcript length (bp)1383
Coding sequence length (bp)1383
Protein length (aa) 461

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 3.6E-05 106 161
PF01764 Lipase_3 Lipase (class 3) 1.1E-14 262 357

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 267 391 1.0E-17
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 7 160 4.0E-08
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 267 399 5.0E-08
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 267 399 7.0E-08
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 263 404 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 267 391 1.0E-17
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 7 160 4.0E-08
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 267 399 5.0E-08
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 267 399 7.0E-08
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 263 404 5.0E-07
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 267 374 1.0E-06
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 267 374 1.0E-06
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 267 399 2.0E-06
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 267 399 2.0E-06
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 267 399 2.0E-06
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 267 399 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1910
MFGFLVLVVALLGMVTGLDLRPSNDTVSPQILRDIYVFAAYSHAAYCGPNRDGNPGNSLCFHPPCAGIISPGTTT
RFEFSSKTAPIAGNVAVMDRGLDKDAPPTVVVSFRGSGNLGNLIQSFRFKLVDFPLCANCSVHTGFMDTYTQIKH
DLSQALNRNVEAALVKRRAPEWENVEGPVYGKHPERLEGKKRDSDDKMEDPPVSADGGKPGISPKGDRKEYMKYL
KQVRDKQKSRDKAWRKTLRDKPSSSRYHLFKPDGNTLFYGEPAPRIVFTGHSYGGAVATIAAAHYRAYGHIVDLY
TYGSPRVGNSFFAEFASRGPFPRLERSGSRGSPGAPHGGITARVTNKRDIIVSNPPMAKPFNYAHVTPEYWFSEG
IANPAFPYNLQVCHGVRELTCASQFRSFTFWNIFDMCRRMIHHAITIYSNDANTCADKKTKIRHHKRDFAGDREG
VSVEIADVWF*
Coding >OphauG2|1910
ATGTTTGGCTTCTTGGTCCTCGTGGTGGCCTTGTTGGGCATGGTGACAGGCCTCGACCTGAGGCCTAGCAATGAC
ACGGTTTCCCCGCAAATATTGCGGGATATATACGTCTTTGCAGCATACTCGCATGCTGCCTACTGCGGCCCCAAC
CGCGACGGCAACCCGGGAAACTCGCTCTGCTTCCACCCCCCCTGCGCAGGCATCATCTCGCCAGGCACGACGACG
CGGTTTGAGTTTAGCAGCAAGACGGCTCCCATTGCGGGCAACGTTGCCGTTATGGACCGCGGCCTCGATAAGGAT
GCCCCGCCTACTGTGGTGGTTTCGTTTCGCGGCAGTGGCAACCTGGGAAACCTTATCCAAAGCTTTCGCTTCAAG
CTGGTGGATTTCCCCCTCTGTGCGAATTGCTCGGTGCACACTGGCTTCATGGATACCTATACACAGATCAAGCAT
GACTTGAGCCAGGCGCTGAATCGAAACGTGGAGGCTGCACTGGTCAAGCGAAGGGCGCCAGAGTGGGAAAATGTT
GAGGGCCCTGTCTATGGCAAGCACCCGGAAAGGCTGGAGGGCAAGAAACGCGACTCGGACGACAAGATGGAGGAT
CCCCCGGTCAGTGCTGATGGCGGCAAGCCGGGCATTAGTCCCAAGGGAGACCGCAAGGAGTACATGAAGTACCTC
AAGCAAGTCCGAGACAAGCAAAAGTCGCGTGACAAGGCGTGGCGCAAGACGCTGAGGGACAAGCCGTCGTCGTCG
CGCTACCACCTGTTCAAGCCCGACGGCAACACGCTGTTCTACGGAGAGCCGGCTCCTCGCATCGTCTTTACCGGC
CACTCGTATGGCGGCGCGGTAGCGACGATTGCGGCTGCGCACTATCGAGCCTATGGTCACATCGTTGACCTGTAC
ACGTATGGCTCGCCTCGGGTCGGCAACAGCTTCTTTGCCGAGTTTGCCAGTCGCGGTCCGTTTCCCCGTCTTGAG
CGCAGCGGCAGCCGAGGCTCCCCGGGGGCTCCCCATGGCGGCATCACGGCTCGCGTCACCAACAAGCGCGACATT
ATTGTCTCGAACCCGCCCATGGCCAAGCCCTTCAACTATGCCCACGTGACGCCCGAGTACTGGTTCAGCGAGGGC
ATTGCCAATCCTGCCTTTCCCTACAACCTGCAGGTGTGCCATGGCGTGCGCGAGCTGACGTGCGCGTCCCAGTTT
CGCTCGTTTACCTTTTGGAATATTTTTGACATGTGTCGGCGCATGATTCACCACGCTATAACCATATATAGCAAC
GACGCCAACACGTGTGCCGACAAGAAGACCAAGATAAGGCACCACAAGCGAGACTTTGCTGGGGACAGGGAGGGT
GTGTCGGTGGAGATTGCCGACGTGTGGTTTTGA
Transcript >OphauG2|1910
ATGTTTGGCTTCTTGGTCCTCGTGGTGGCCTTGTTGGGCATGGTGACAGGCCTCGACCTGAGGCCTAGCAATGAC
ACGGTTTCCCCGCAAATATTGCGGGATATATACGTCTTTGCAGCATACTCGCATGCTGCCTACTGCGGCCCCAAC
CGCGACGGCAACCCGGGAAACTCGCTCTGCTTCCACCCCCCCTGCGCAGGCATCATCTCGCCAGGCACGACGACG
CGGTTTGAGTTTAGCAGCAAGACGGCTCCCATTGCGGGCAACGTTGCCGTTATGGACCGCGGCCTCGATAAGGAT
GCCCCGCCTACTGTGGTGGTTTCGTTTCGCGGCAGTGGCAACCTGGGAAACCTTATCCAAAGCTTTCGCTTCAAG
CTGGTGGATTTCCCCCTCTGTGCGAATTGCTCGGTGCACACTGGCTTCATGGATACCTATACACAGATCAAGCAT
GACTTGAGCCAGGCGCTGAATCGAAACGTGGAGGCTGCACTGGTCAAGCGAAGGGCGCCAGAGTGGGAAAATGTT
GAGGGCCCTGTCTATGGCAAGCACCCGGAAAGGCTGGAGGGCAAGAAACGCGACTCGGACGACAAGATGGAGGAT
CCCCCGGTCAGTGCTGATGGCGGCAAGCCGGGCATTAGTCCCAAGGGAGACCGCAAGGAGTACATGAAGTACCTC
AAGCAAGTCCGAGACAAGCAAAAGTCGCGTGACAAGGCGTGGCGCAAGACGCTGAGGGACAAGCCGTCGTCGTCG
CGCTACCACCTGTTCAAGCCCGACGGCAACACGCTGTTCTACGGAGAGCCGGCTCCTCGCATCGTCTTTACCGGC
CACTCGTATGGCGGCGCGGTAGCGACGATTGCGGCTGCGCACTATCGAGCCTATGGTCACATCGTTGACCTGTAC
ACGTATGGCTCGCCTCGGGTCGGCAACAGCTTCTTTGCCGAGTTTGCCAGTCGCGGTCCGTTTCCCCGTCTTGAG
CGCAGCGGCAGCCGAGGCTCCCCGGGGGCTCCCCATGGCGGCATCACGGCTCGCGTCACCAACAAGCGCGACATT
ATTGTCTCGAACCCGCCCATGGCCAAGCCCTTCAACTATGCCCACGTGACGCCCGAGTACTGGTTCAGCGAGGGC
ATTGCCAATCCTGCCTTTCCCTACAACCTGCAGGTGTGCCATGGCGTGCGCGAGCTGACGTGCGCGTCCCAGTTT
CGCTCGTTTACCTTTTGGAATATTTTTGACATGTGTCGGCGCATGATTCACCACGCTATAACCATATATAGCAAC
GACGCCAACACGTGTGCCGACAAGAAGACCAAGATAAGGCACCACAAGCGAGACTTTGCTGGGGACAGGGAGGGT
GTGTCGGTGGAGATTGCCGACGTGTGGTTTTGA
Gene >OphauG2|1910
ATGTTTGGCTTCTTGGTCCTCGTGGTGGCCTTGTTGGGCATGGTGACAGGCCTCGACCTGAGGCCTAGCAATGAC
ACGGTTTCCCCGCGTAAGCCCTTTTTTTTTTCCCTTTTGTCAAGTCGACACCCTTGCCAAGGCATTGCTAACAAG
GTGTAGAAATATTGCGGGATATATACGTCTTTGCAGCATACTCGCATGCTGCCTACTGCGGCCCCAACCGCGACG
GCAACCCGGGAAACTCGCTCTGCTTCCACCCCCCCTGCGCAGGCATCATCTCGCCAGGCACGACGACGCGGTTTG
AGTTTAGCAGCAAGACGGCTCCCATTGCGGGCAACGTTGCCGTTATGGACCGCGGCCTCGATAAGGATGCCCCGC
CTACTGTGGTGGTTTCGTTTCGCGGCAGTGGCAACCTGGGAAACCTTATCCAAAGCTTTCGCTTCAAGCTGGTGG
ATTTCCCCCTCTGTGCGAATTGCTCGGTGCACACTGGCTTCATGGATACCTATACACAGATCAAGCATGACTTGA
GCCAGGCGCTGAATCGAAACGTGGAGGCTGCACTGGTCAAGCGAAGGGCGCCAGAGTGGGAAAATGTTGAGGGCC
CTGTCTATGGCAAGCACCCGGAAAGGCTGGAGGGCAAGAAACGCGACTCGGACGACAAGATGGAGGATCCCCCGG
TCAGTGCTGATGGCGGCAAGCCGGGCATTAGTCCCAAGGGAGACCGCAAGGAGTACATGAAGTACCTCAAGCAAG
TCCGAGACAAGCAAAAGTCGCGTGACAAGGCGTGGCGCAAGACGCTGAGGGACAAGCCGTCGTCGTCGCGCTACC
ACCTGTTCAAGCCCGACGGCAACACGCTGTTCTACGGAGAGCCGGCTCCTCGCATCGTCTTTACCGGCCACTCGT
ATGGCGGCGCGGTAGCGACGATTGCGGCTGCGCACTATCGAGCCTATGGTCACATCGTTGACCTGTACACGTATG
GCTCGCCTCGGGTCGGCAACAGCTTCTTTGCCGAGTTTGCCAGTCGCGGTCCGTTTCCCCGTCTTGAGCGCAGCG
GCAGCCGAGGCTCCCCGGGGGCTCCCCATGGCGGCATCACGGCTCGCGTCACCAACAAGCGCGACATTATTGTCT
CGAACCCGCCCATGGCCAAGCCCTTCAACTATGCCCACGTGACGCCCGAGTACTGGTTCAGCGAGGGCATTGCCA
ATCCTGCCTTTCCCTACAACCTGCAGGTGTGCCATGGCGTGCGCGAGCTGACGTGCGCGTCCCAGTTTCGCTCGT
TTACCTTTTGGAATATTTTTGACATGTGTCGGCGCATGATTCACCACGCTATAACCATATATAGCAACGACGCCA
ACACGTGTGCCGACAAGAAGACCAAGATAAGGCACCACAAGCGAGACTTTGCTGGGGACAGGGAGGGTGTGTCGG
TGGAGATTGCCGACGTGTGGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail