Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1898
Gene name
LocationContig_161:13412..14653
Strand-
Gene length (bp)1241
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07970 COPIIcoated_ERV Endoplasmic reticulum vesicle transporter 1.7E-33 180 333
PF13850 ERGIC_N Endoplasmic Reticulum-Golgi Intermediate Compartment (ERGIC) 6.1E-25 22 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94283|ERV41_SCHPO ER-derived vesicles protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv41 PE=1 SV=1 21 362 6.0E-45
sp|Q4R5C3|ERGI2_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Macaca fascicularis GN=ERGIC2 PE=2 SV=1 19 353 7.0E-42
sp|Q04651|ERV41_YEAST ER-derived vesicles protein ERV41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV41 PE=1 SV=1 21 351 8.0E-42
sp|Q96RQ1|ERGI2_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Homo sapiens GN=ERGIC2 PE=1 SV=2 19 353 2.0E-41
sp|Q9CR89|ERGI2_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Mus musculus GN=Ergic2 PE=1 SV=1 19 353 5.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94283|ERV41_SCHPO ER-derived vesicles protein 41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erv41 PE=1 SV=1 21 362 6.0E-45
sp|Q4R5C3|ERGI2_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Macaca fascicularis GN=ERGIC2 PE=2 SV=1 19 353 7.0E-42
sp|Q04651|ERV41_YEAST ER-derived vesicles protein ERV41 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV41 PE=1 SV=1 21 351 8.0E-42
sp|Q96RQ1|ERGI2_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Homo sapiens GN=ERGIC2 PE=1 SV=2 19 353 2.0E-41
sp|Q9CR89|ERGI2_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Mus musculus GN=Ergic2 PE=1 SV=1 19 353 5.0E-41
sp|Q5EHU7|ERGI2_GECJA Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Gecko japonicus GN=ERGIC2 PE=2 SV=1 19 353 5.0E-40
sp|Q7T2D4|ERGI2_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 2 OS=Danio rerio GN=ergic2 PE=2 SV=1 19 331 3.0E-38
sp|Q803I2|ERGI3_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Danio rerio GN=ergic3 PE=2 SV=1 21 334 7.0E-36
sp|Q6NVS2|ERGI3_XENTR Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus tropicalis GN=ergic3 PE=2 SV=1 24 334 9.0E-35
sp|Q66KH2|ERGI3_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Xenopus laevis GN=ergic3 PE=2 SV=1 24 334 1.0E-34
sp|Q4R8X1|ERGI3_MACFA Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Macaca fascicularis GN=ERGIC3 PE=2 SV=1 21 334 5.0E-32
sp|Q9Y282|ERGI3_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens GN=ERGIC3 PE=1 SV=1 21 334 7.0E-31
sp|Q9CQE7|ERGI3_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Mus musculus GN=Ergic3 PE=1 SV=1 21 334 9.0E-31
sp|Q54DW2|ERGI3_DICDI Probable endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Dictyostelium discoideum GN=ergic3 PE=3 SV=1 19 333 9.0E-31
sp|Q5R8G3|ERGI3_PONAB Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Pongo abelii GN=ERGIC3 PE=2 SV=1 21 334 1.0E-30
sp|Q5EAE0|ERGI3_BOVIN Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Bos taurus GN=ERGIC3 PE=2 SV=1 21 334 2.0E-29
sp|Q09895|YAI8_SCHPO Uncharacterized protein C24B11.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.08c PE=3 SV=1 19 331 7.0E-17
sp|P39727|ERV46_YEAST ER-derived vesicles protein ERV46 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERV46 PE=1 SV=2 17 334 2.0E-15
sp|Q969X5|ERGI1_HUMAN Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Homo sapiens GN=ERGIC1 PE=1 SV=1 173 350 6.0E-08
sp|Q6NS19|ERGI1_XENLA Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Xenopus laevis GN=ergic1 PE=2 SV=1 184 352 8.0E-08
sp|Q9DC16|ERGI1_MOUSE Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Mus musculus GN=Ergic1 PE=1 SV=1 173 350 2.0E-07
sp|Q4V8Y6|ERGI1_DANRE Endoplasmic reticulum-Golgi intermediate compartment protein 1 OS=Danio rerio GN=ergic1 PE=2 SV=1 184 350 1.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4455
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1898 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2009
Ophiocordyceps camponoti-floridani Ophcf2|06882
Ophiocordyceps camponoti-rufipedis Ophun1|5001
Ophiocordyceps kimflemingae Ophio5|4518
Ophiocordyceps subramaniannii Hirsu2|925

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1898
MNGFQEKQLNEADFGAKGSIVSAFDAFPKSKPEYVTRTAGGGKWTVAMVLVSLILMWSEATRWWRGTESHAFAVE
KGVSHSMQINLDIVVHMKCSDLHVNVQDASGDRILAATRLQSDPTNWSQWANAHGVHRLGRDSHGRIVTGAGWDD
EGFGEEHVHDIVAAGKKRARWSKTPRLHGAADSCRMYGSLELNKVQGDFHITARGHGYIEFGEHLDHSTFNFSHI
ISELSYGPFYPSLVNPLDRTVNTAPNHFHKFQYYLSVVPTVYSVGSSSITTNQYAVTEQSKGISEFSVPGIFFKY
DIEPILLAVREDRDGMLVFLVKLINVLSGVLVAGHWGFTLSEWLREVLGRRRRSSGGEGVLGSKSGYDE*
Coding >OphauG2|1898
ATGAACGGCTTCCAAGAAAAGCAGCTCAACGAGGCCGACTTTGGCGCCAAGGGCAGCATTGTCAGCGCCTTTGAT
GCCTTTCCAAAATCCAAGCCCGAATATGTCACGCGCACTGCTGGGGGCGGCAAATGGACCGTGGCCATGGTGCTC
GTCTCCCTCATCCTCATGTGGAGCGAGGCCACGCGCTGGTGGCGAGGAACCGAGTCACATGCCTTTGCCGTGGAA
AAGGGCGTTTCGCACTCCATGCAGATCAATCTCGATATTGTAGTCCACATGAAGTGCAGCGACTTGCATGTCAAC
GTCCAGGATGCATCGGGCGACCGCATCCTCGCCGCCACGCGCCTGCAGAGCGACCCAACCAATTGGTCGCAGTGG
GCCAACGCCCACGGTGTCCACCGACTGGGCCGCGACAGCCACGGCCGCATTGTCACGGGTGCAGGCTGGGACGAC
GAGGGCTTTGGCGAGGAGCACGTCCATGACATTGTTGCTGCCGGCAAGAAGCGTGCCAGGTGGTCAAAGACGCCC
AGGTTGCATGGCGCTGCTGATAGCTGCCGCATGTATGGCAGCCTTGAGCTCAACAAGGTTCAGGGCGACTTTCAC
ATCACCGCCCGCGGCCACGGCTACATTGAGTTTGGCGAGCACCTAGATCATAGCACCTTCAATTTCTCCCATATC
ATCTCAGAGTTGTCATATGGCCCCTTCTACCCGTCGCTCGTGAATCCCCTCGATCGAACCGTCAACACGGCCCCG
AATCATTTTCACAAGTTCCAATACTACCTCTCCGTCGTCCCAACCGTCTATAGCGTCGGGTCGAGCTCCATCACA
ACAAACCAATATGCCGTTACAGAACAGAGCAAAGGAATATCCGAGTTTTCCGTTCCCGGCATTTTCTTCAAGTAC
GACATTGAGCCTATACTCTTGGCCGTGCGCGAAGACCGAGACGGTATGCTCGTCTTCCTCGTTAAACTCATCAAT
GTGCTGAGTGGCGTTCTCGTCGCTGGCCACTGGGGCTTTACTTTGAGTGAATGGTTACGCGAGGTGCTTGGTCGT
CGGAGGCGCAGCAGCGGCGGCGAGGGAGTTTTGGGGTCAAAGAGCGGCTATGACGAGTAG
Transcript >OphauG2|1898
ATGAACGGCTTCCAAGAAAAGCAGCTCAACGAGGCCGACTTTGGCGCCAAGGGCAGCATTGTCAGCGCCTTTGAT
GCCTTTCCAAAATCCAAGCCCGAATATGTCACGCGCACTGCTGGGGGCGGCAAATGGACCGTGGCCATGGTGCTC
GTCTCCCTCATCCTCATGTGGAGCGAGGCCACGCGCTGGTGGCGAGGAACCGAGTCACATGCCTTTGCCGTGGAA
AAGGGCGTTTCGCACTCCATGCAGATCAATCTCGATATTGTAGTCCACATGAAGTGCAGCGACTTGCATGTCAAC
GTCCAGGATGCATCGGGCGACCGCATCCTCGCCGCCACGCGCCTGCAGAGCGACCCAACCAATTGGTCGCAGTGG
GCCAACGCCCACGGTGTCCACCGACTGGGCCGCGACAGCCACGGCCGCATTGTCACGGGTGCAGGCTGGGACGAC
GAGGGCTTTGGCGAGGAGCACGTCCATGACATTGTTGCTGCCGGCAAGAAGCGTGCCAGGTGGTCAAAGACGCCC
AGGTTGCATGGCGCTGCTGATAGCTGCCGCATGTATGGCAGCCTTGAGCTCAACAAGGTTCAGGGCGACTTTCAC
ATCACCGCCCGCGGCCACGGCTACATTGAGTTTGGCGAGCACCTAGATCATAGCACCTTCAATTTCTCCCATATC
ATCTCAGAGTTGTCATATGGCCCCTTCTACCCGTCGCTCGTGAATCCCCTCGATCGAACCGTCAACACGGCCCCG
AATCATTTTCACAAGTTCCAATACTACCTCTCCGTCGTCCCAACCGTCTATAGCGTCGGGTCGAGCTCCATCACA
ACAAACCAATATGCCGTTACAGAACAGAGCAAAGGAATATCCGAGTTTTCCGTTCCCGGCATTTTCTTCAAGTAC
GACATTGAGCCTATACTCTTGGCCGTGCGCGAAGACCGAGACGGTATGCTCGTCTTCCTCGTTAAACTCATCAAT
GTGCTGAGTGGCGTTCTCGTCGCTGGCCACTGGGGCTTTACTTTGAGTGAATGGTTACGCGAGGTGCTTGGTCGT
CGGAGGCGCAGCAGCGGCGGCGAGGGAGTTTTGGGGTCAAAGAGCGGCTATGACGAGTAG
Gene >OphauG2|1898
ATGAACGGCTTCCAAGAAAAGCAGCTCAACGAGGCCGACTTTGGCGCCAAGGGCAGCATTGTCAGCGCCTTTGAT
GCCTTTCGTATGTCTCAAGCCATCCCCCCGCCATGGCCCACCACGGGCCTCTCCTCCCCCTCCTTGCTGACCCGG
CTTGGTAGCAAAATCCAAGCCCGAATATGTCACGCGCACTGCTGGGGGCGGCAAATGGACCGTGGCCATGGTGCT
CGTCTCCCTCATCCTCATGTGGAGCGAGGCCACGCGCTGGTGGCGAGGAACCGAGTCACATGCCTTTGCCGTGGA
AAAGGGCGTTTCGCACTCCATGCAGATCAATCTCGATATTGTAGTCCACATGAAGTGCAGCGACTTGCATGTCAA
CGTCCAGGATGCATCGGGCGACCGCATCCTCGCCGCCACGCGCCTGCAGAGCGACCCAACCAATTGGTCGCAGTG
GGCCAACGCCCACGGTGTCCACCGACTGGGCCGCGACAGCCACGGCCGCATTGTCACGGGTGCAGGCTGGGACGA
CGAGGGCTTTGGCGAGGAGCACGTCCATGACATTGTTGCTGCCGGCAAGAAGCGTGCCAGGTGGTCAAAGACGCC
CAGGTTGCATGGCGCTGCTGATAGCTGCCGCATGTATGGCAGCCTTGAGCTCAACAAGGTTCAGGGCGACTTTCA
CATCACCGCCCGCGGCCACGGCTACATTGAGTTTGGCGAGCACCTAGATCATAGCAGTAAGTCCCACCAGTAAGA
TGACTCTTTGCAATCCACCTTTTAACCTTGAAACAGCCTTCAATTTCTCCCATATCATCTCAGAGTTGTCATATG
GCCCCTTCTACCCGTCGCTCGTGAATCCCCTCGATCGAACCGTCAACACGGCCCCGAATCATTTTCACAAGTTCC
AATACTACCTCTCCGTCGTCCCAACCGTCTATAGCGTCGGGTCGAGCTCCATCACAACAAACCAATATGCCGTTA
CAGAACAGAGCAAAGGAATATCCGAGTTTTCCGTTCCCGGCATTTTCTTCAAGTACGACATTGAGCCTATACTCT
TGGCCGTGCGCGAAGACCGAGACGGTATGCTCGTCTTCCTCGTTAAACTCATCAATGTGCTGAGTGGCGTTCTCG
TCGCTGGCCACTGGGGCTTTACTTTGAGTGAATGGTTACGCGAGGTGCTTGGTCGTCGGAGGCGCAGCAGCGGCG
GCGAGGGAGTTTTGGGGTCAAAGAGCGGCTATGACGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail