Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1895
Gene name
LocationContig_161:4415..5941
Strand+
Gene length (bp)1526
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 2.1E-21 225 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 35 384 2.0E-91
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 35 383 6.0E-91
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 65 373 1.0E-27
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 65 373 5.0E-27
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 55 364 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 35 384 2.0E-91
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 35 383 6.0E-91
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 65 373 1.0E-27
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 65 373 5.0E-27
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 55 364 3.0E-23
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 61 374 3.0E-21
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 225 371 7.0E-19
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 63 364 8.0E-19
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 61 374 1.0E-18
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 61 364 5.0E-18
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 61 374 1.0E-17
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 213 365 4.0E-17
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 213 365 8.0E-17
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 225 371 1.0E-16
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 63 365 1.0E-16
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 61 372 1.0E-16
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 225 364 1.0E-16
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 51 369 6.0E-16
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 213 365 9.0E-16
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 80 369 1.0E-15
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 225 374 4.0E-15
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 208 371 4.0E-15
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 225 374 4.0E-15
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 213 382 5.0E-15
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 225 365 7.0E-15
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 213 365 8.0E-15
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 63 364 9.0E-15
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 213 382 1.0E-14
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 213 365 1.0E-14
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 213 365 1.0E-14
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 213 365 2.0E-14
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 225 382 2.0E-14
sp|P59049|OMT1_CHRAE Quercetin 3-O-methyltransferase 1 OS=Chrysosplenium americanum GN=OMT1 PE=1 SV=1 225 382 2.0E-14
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 213 365 3.0E-14
sp|Q86I40|OMT4_DICDI O-methyltransferase 4 OS=Dictyostelium discoideum GN=omt4 PE=3 SV=1 80 375 3.0E-14
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 99 371 4.0E-14
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 213 365 5.0E-14
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 225 360 5.0E-14
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 93 365 7.0E-14
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 225 372 8.0E-14
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 225 364 9.0E-14
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 225 365 1.0E-13
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 225 365 1.0E-13
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 225 365 1.0E-13
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 225 364 4.0E-13
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 225 365 5.0E-13
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 225 365 5.0E-13
sp|Q6WUC2|7OMT_PAPSO (R,S)-reticuline 7-O-methyltransferase OS=Papaver somniferum GN=7OMT PE=1 SV=1 225 374 5.0E-13
sp|P45986|IMT1_MESCR Inositol 4-methyltransferase OS=Mesembryanthemum crystallinum GN=IMT1 PE=1 SV=1 213 364 1.0E-12
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 225 365 1.0E-12
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 225 381 1.0E-12
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 225 365 1.0E-12
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 225 364 4.0E-12
sp|A9X7L0|ANMT_RUTGR Anthranilate N-methyltransferase OS=Ruta graveolens PE=1 SV=1 225 365 5.0E-12
sp|Q7XXD4|METL_ORYSJ Probable inactive methyltransferase Os04g0175900 OS=Oryza sativa subsp. japonica GN=Os04g0175900 PE=1 SV=2 77 373 5.0E-12
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 225 364 6.0E-12
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 225 364 6.0E-12
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 225 365 7.0E-12
sp|Q0IP69|NOMT_ORYSJ Naringenin 7-O-methyltransferase OS=Oryza sativa subsp. japonica GN=Os12g0240900 PE=1 SV=2 238 373 6.0E-11
sp|B8RCD3|AIMT1_PIMAN Trans-anol O-methyltransferase 1 OS=Pimpinella anisum GN=AIMT1 PE=1 SV=1 86 364 7.0E-11
sp|Q93WU3|CVMT1_OCIBA Chavicol O-methyltransferase OS=Ocimum basilicum GN=CVOMT1 PE=1 SV=1 225 376 8.0E-11
sp|Q9SWC2|COMT1_EUCGL Caffeic acid 3-O-methyltransferase (Fragment) OS=Eucalyptus globulus GN=COMT1 PE=3 SV=1 225 351 8.0E-11
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 225 365 1.0E-10
sp|Q6ZD89|OMT1_ORYSJ Flavone 3'-O-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=ROMT-9 PE=1 SV=1 243 364 2.0E-10
sp|C6TAY1|SOMT2_SOYBN Flavonoid 4'-O-methyltransferase OS=Glycine max PE=1 SV=1 225 372 5.0E-10
sp|O24305|M3OM1_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 1 OS=Pisum sativum GN=HMM1 PE=1 SV=1 63 364 7.0E-10
sp|A8QW53|OMT3_SORBI 5-pentadecatrienyl resorcinol O-methyltransferase OS=Sorghum bicolor GN=OMT3 PE=1 SV=1 225 365 9.0E-10
sp|A8QW51|OMT2_SORBI Probable O-methyltransferase 2 OS=Sorghum bicolor GN=OMT2 PE=2 SV=1 60 364 3.0E-09
sp|Q93WU2|EOMT1_OCIBA Eugenol O-methyltransferase OS=Ocimum basilicum GN=EOMT1 PE=1 SV=1 225 376 2.0E-08
sp|B6VJS4|ROMT_VITVI Trans-resveratrol di-O-methyltransferase OS=Vitis vinifera GN=ROMT PE=1 SV=2 225 383 2.0E-08
sp|Q84N28|FOMT1_WHEAT Flavone O-methyltransferase 1 OS=Triticum aestivum GN=OMT1 PE=1 SV=1 239 365 3.0E-08
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 225 364 3.0E-07
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 225 375 4.0E-07
sp|Q54FP4|OMT10_DICDI O-methyltransferase 10 OS=Dictyostelium discoideum GN=omt10 PE=3 SV=2 274 372 4.0E-07
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 268 364 1.0E-06
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 268 364 1.0E-06
sp|P0DH60|M3OM2_PEA (+)-6a-hydroxymaackiain 3-O-methyltransferase 2 OS=Pisum sativum GN=HMM2 PE=1 SV=1 63 364 1.0E-06
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 225 371 1.0E-06
sp|Q84KK4|I4OMT_LOTJA Isoflavone 4'-O-methyltransferase OS=Lotus japonicus GN=HI4'OMT PE=1 SV=1 63 328 2.0E-06
sp|Q29U70|I4OMT_MEDTR Isoflavone 4'-O-methyltransferase OS=Medicago truncatula GN=HI4'OMT PE=1 SV=1 241 364 2.0E-06
sp|Q84HC8|NCSB1_STRCZ 2,7-dihydroxy-5-methyl-1-naphthoate 7-O-methyltransferase OS=Streptomyces carzinostaticus GN=ncsB1 PE=1 SV=1 274 383 8.0E-06
sp|P47917|ZRP4_MAIZE O-methyltransferase ZRP4 OS=Zea mays GN=ZRP4 PE=2 SV=1 225 374 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No
GO:0008168 methyltransferase activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1895
MGKEAYKTKIDALIESLRQVAGESEEARFDTSIALRDLRRSLATPDDVYDRFEKGNLEICVSRIAQDLEIYQTLA
SSQEPMSVDALAAKAGAAPKLLHRILRYLASLGQISETGPNTFAANAETRTLATPGFRGLTYHTFHTVHPLLQGV
PDFLADRKYRDVTTTTDTATQRVFNTPLPVFTWFPTQPKRFEYLQQFMAVQPYGVPWFSVYPLHTHLGNNDDVFL
VDVGGGLGHQCARLIEAYPELKGKLVLQDYQEALDQAPPLEGVEKMAHNFFTKQPVKGAHIYYLRHVLHDWPDEE
CLVILKHLKDAMGPESLILIDDMVLPDTGVHERAAALDLLLMSSHGAKERTADDWRALTTAAGLRIQSIETYFPR
RHSSIIQVGLM*
Coding >OphauG2|1895
ATGGGGAAGGAGGCTTACAAGACGAAGATCGATGCTCTTATCGAGAGCCTGCGTCAAGTGGCGGGCGAGAGCGAA
GAGGCTCGATTTGACACGTCGATTGCTCTGCGTGACTTGCGCCGGTCCCTCGCCACGCCTGACGATGTATACGAT
CGTTTTGAGAAGGGGAATCTCGAGATTTGCGTCTCACGCATCGCTCAGGATCTAGAGATTTACCAGACGCTAGCG
AGTAGCCAGGAGCCCATGAGTGTGGACGCGCTGGCGGCCAAGGCTGGGGCGGCACCTAAACTATTGCATCGCATC
TTGCGCTACCTAGCCTCACTCGGCCAAATCTCAGAAACAGGCCCCAACACCTTTGCCGCCAACGCCGAGACACGA
ACCCTGGCCACGCCCGGCTTCCGAGGCCTCACCTATCACACCTTTCACACCGTCCACCCTCTCCTCCAAGGGGTG
CCCGACTTCCTCGCCGACCGCAAATACCGCGACGTCACCACCACCACCGACACGGCTACCCAGCGCGTCTTCAAC
ACGCCTCTGCCCGTCTTTACCTGGTTTCCCACACAGCCCAAGCGCTTCGAGTACCTGCAGCAATTCATGGCCGTT
CAGCCATACGGCGTGCCTTGGTTTTCCGTCTACCCTTTGCATACGCACCTTGGGAACAACGACGATGTGTTTCTG
GTTGACGTGGGCGGCGGCCTCGGCCATCAGTGTGCTCGGCTCATAGAGGCATATCCCGAGCTCAAGGGCAAGCTG
GTGCTCCAGGACTACCAGGAGGCGCTTGATCAGGCTCCACCGCTGGAGGGCGTCGAGAAGATGGCGCACAACTTC
TTCACCAAACAGCCCGTCAAGGGCGCGCACATCTATTACCTGAGACACGTTCTGCACGACTGGCCCGACGAGGAG
TGCCTGGTCATCCTCAAGCACCTCAAGGACGCCATGGGGCCCGAGTCGCTGATTCTGATTGATGACATGGTCCTG
CCCGACACTGGCGTTCATGAACGGGCCGCCGCCCTGGATCTGCTTCTCATGTCGTCGCATGGCGCCAAGGAGCGC
ACGGCGGATGACTGGCGCGCCTTGACCACGGCTGCCGGCTTGCGCATCCAAAGCATCGAAACCTATTTCCCTCGT
CGCCACAGCTCCATTATCCAAGTCGGGCTCATGTAG
Transcript >OphauG2|1895
ATGGGGAAGGAGGCTTACAAGACGAAGATCGATGCTCTTATCGAGAGCCTGCGTCAAGTGGCGGGCGAGAGCGAA
GAGGCTCGATTTGACACGTCGATTGCTCTGCGTGACTTGCGCCGGTCCCTCGCCACGCCTGACGATGTATACGAT
CGTTTTGAGAAGGGGAATCTCGAGATTTGCGTCTCACGCATCGCTCAGGATCTAGAGATTTACCAGACGCTAGCG
AGTAGCCAGGAGCCCATGAGTGTGGACGCGCTGGCGGCCAAGGCTGGGGCGGCACCTAAACTATTGCATCGCATC
TTGCGCTACCTAGCCTCACTCGGCCAAATCTCAGAAACAGGCCCCAACACCTTTGCCGCCAACGCCGAGACACGA
ACCCTGGCCACGCCCGGCTTCCGAGGCCTCACCTATCACACCTTTCACACCGTCCACCCTCTCCTCCAAGGGGTG
CCCGACTTCCTCGCCGACCGCAAATACCGCGACGTCACCACCACCACCGACACGGCTACCCAGCGCGTCTTCAAC
ACGCCTCTGCCCGTCTTTACCTGGTTTCCCACACAGCCCAAGCGCTTCGAGTACCTGCAGCAATTCATGGCCGTT
CAGCCATACGGCGTGCCTTGGTTTTCCGTCTACCCTTTGCATACGCACCTTGGGAACAACGACGATGTGTTTCTG
GTTGACGTGGGCGGCGGCCTCGGCCATCAGTGTGCTCGGCTCATAGAGGCATATCCCGAGCTCAAGGGCAAGCTG
GTGCTCCAGGACTACCAGGAGGCGCTTGATCAGGCTCCACCGCTGGAGGGCGTCGAGAAGATGGCGCACAACTTC
TTCACCAAACAGCCCGTCAAGGGCGCGCACATCTATTACCTGAGACACGTTCTGCACGACTGGCCCGACGAGGAG
TGCCTGGTCATCCTCAAGCACCTCAAGGACGCCATGGGGCCCGAGTCGCTGATTCTGATTGATGACATGGTCCTG
CCCGACACTGGCGTTCATGAACGGGCCGCCGCCCTGGATCTGCTTCTCATGTCGTCGCATGGCGCCAAGGAGCGC
ACGGCGGATGACTGGCGCGCCTTGACCACGGCTGCCGGCTTGCGCATCCAAAGCATCGAAACCTATTTCCCTCGT
CGCCACAGCTCCATTATCCAAGTCGGGCTCATGTAG
Gene >OphauG2|1895
ATGGGGAAGGAGGCTTACAAGACGAAGATCGATGCTCTTATCGAGAGCCTGCGTCAAGTGGCGGGCGAGAGCGAA
GAGGCTCGATTTGACACGTCGATTGCTCTGCGTGACTTGCGCCGGTCCCTCGCCACGCCTGACGATGTATACGAT
CGTTTTGAGAAGGGGAATCTCGAGATTTGCGTCTCACGCATCGCTCAGGATCTAGAGATTTACCAGACGCTAGCG
AGTAGCCAGGAGCCCATGAGTGTGGACGCGCTGGCGGCCAAGGCTGGGGCGGCACCTAAACTATTGCGTTGGTCT
ATCCCTGCGTTTTTGTTTTTACCGCCTCTCTCTATACACTTACTCTCTTTTACTTGCTTTCTCTTTTACTCCCTC
TTATTCCCTCTCACTAACTCTTACTCTTACTCTTACTCTCACTCTCACTCTCACTCTTACTCTCACTCACCCACA
CTCACTCACTCTTACCTACTCTCACTTACTCTTACTTACTCTCGCTTTTCTCACTTACTCTTACTTACTCTTAAT
TACTCTTACTTACTCTCGCTTTTCTCACTTACTCTTACTTACTCTCACTTACTCTCACTCCCTCTCTCTCTTAAC
CTCTCTCAACACTTGGCTGTATTTCCTAGTTTCGGCCCTGGCTGACAAGTTTTATAGATCGCATCTTGCGCTACC
TAGCCTCACTCGGCCAAATCTCAGAAACAGGCCCCAACACCTTTGCCGCCAACGCCGAGACACGAACCCTGGCCA
CGCCCGGCTTCCGAGGCCTCACCTATCACACCTTTCACACCGTCCACCCTCTCCTCCAAGGGGTGCCCGACTTCC
TCGCCGACCGCAAATACCGCGACGTCACCACCACCACCGACACGGCTACCCAGCGCGTCTTCAACACGCCTCTGC
CCGTCTTTACCTGGTTTCCCACACAGCCCAAGCGCTTCGAGTACCTGCAGCAATTCATGGCCGTTCAGCCATACG
GCGTGCCTTGGTTTTCCGTCTACCCTTTGCATACGCACCTTGGGAACAACGACGATGTGTTTCTGGTTGACGTGG
GCGGCGGCCTCGGCCATCAGTGTGCTCGGCTCATAGAGGCATATCCCGAGCTCAAGGGCAAGCTGGTGCTCCAGG
ACTACCAGGAGGCGCTTGATCAGGCTCCACCGCTGGAGGGCGTCGAGAAGATGGCGCACAACTTCTTCACCAAAC
AGCCCGTCAAGGGCGCGCACATCTATTACCTGAGACACGTTCTGCACGACTGGCCCGACGAGGAGTGCCTGGTCA
TCCTCAAGCACCTCAAGGACGCCATGGGGCCCGAGTCGCTGATTCTGATTGATGACATGGTCCTGCCCGACACTG
GCGTTCATGAACGGGCCGCCGCCCTGGATCTGCTTCTCATGTCGTCGCATGGCGCCAAGGAGCGCACGGCGGATG
ACTGGCGCGCCTTGACCACGGCTGCCGGCTTGCGCATCCAAAGCATCGAAACCTATTTCCCTCGTCGCCACAGCT
CCATTATCCAAGTCGGGCTCATGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail