Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|188
Gene name
LocationContig_1033:31..960
Strand-
Gene length (bp)929
Transcript length (bp)870
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13649 Methyltransf_25 Methyltransferase domain 6.2E-09 53 148
PF13489 Methyltransf_23 Methyltransferase domain 7.0E-09 49 202
PF08242 Methyltransf_12 Methyltransferase domain 9.7E-08 55 150
PF08241 Methyltransf_11 Methyltransferase domain 1.4E-06 55 151

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|188
MRPIVYTLDKGGVQDDEVQRLNAQHPIITAVTGSLMPHVVRKHLDALGRRPAVADIGTGTGIWLQSIAKDLPSDA
QLDGYDISSTVFPKAPWQPANMRLIEANALEPFDDEVLGSYDVVHVRLMAYCLAREQWQLLARNLVPLLRPGGYI
FWEECGYPCMTCVPLTKTFQKVAGLDARYAASMGRDVTMPSGLLRHLQNAGYTDLGLTTHDSFSLGDSFQKSAQY
LIISALKQSMHGIVALGGSEWLRSDDDVERAVKQLYAEADELGCRYGFQLYHLVGRAPQSERDG*
Coding >OphauG2|188
ATGAGGCCCATTGTTTATACCCTTGACAAGGGCGGCGTCCAGGACGACGAGGTCCAGCGGCTGAATGCCCAGCAC
CCCATCATAACGGCCGTTACAGGAAGCCTGATGCCGCACGTGGTGCGCAAGCACCTTGATGCCCTAGGCCGCCGG
CCGGCCGTGGCAGACATTGGCACGGGGACTGGCATCTGGCTACAGAGCATCGCCAAAGACCTGCCCAGCGACGCG
CAGCTAGACGGCTATGATATCAGCAGCACGGTTTTCCCCAAGGCACCGTGGCAGCCGGCAAACATGCGGCTCATC
GAGGCCAATGCCCTTGAGCCGTTTGACGACGAGGTGTTGGGGAGCTATGATGTCGTTCATGTGCGGCTGATGGCC
TACTGCCTGGCCAGGGAGCAATGGCAGTTGTTGGCGAGGAATCTGGTGCCTCTTTTGCGGCCGGGAGGCTACATC
TTTTGGGAAGAGTGCGGATACCCGTGCATGACGTGCGTTCCCTTGACCAAGACTTTTCAGAAGGTTGCTGGCCTG
GATGCCCGATATGCAGCCAGCATGGGCAGAGATGTTACAATGCCCTCTGGTCTCTTGCGACACTTGCAAAACGCA
GGCTACACCGACCTTGGCCTGACAACCCATGACTCCTTCTCCCTGGGCGACTCGTTTCAAAAGTCGGCGCAGTAC
CTCATCATTTCAGCCTTGAAGCAGTCTATGCACGGCATCGTTGCCCTCGGGGGGTCTGAGTGGTTGCGCTCAGAC
GACGACGTTGAGCGCGCCGTGAAGCAACTGTACGCGGAAGCAGATGAGCTTGGCTGTCGGTACGGCTTCCAACTC
TATCACCTTGTCGGTCGAGCGCCGCAGTCTGAACGAGATGGCTAG
Transcript >OphauG2|188
ATGAGGCCCATTGTTTATACCCTTGACAAGGGCGGCGTCCAGGACGACGAGGTCCAGCGGCTGAATGCCCAGCAC
CCCATCATAACGGCCGTTACAGGAAGCCTGATGCCGCACGTGGTGCGCAAGCACCTTGATGCCCTAGGCCGCCGG
CCGGCCGTGGCAGACATTGGCACGGGGACTGGCATCTGGCTACAGAGCATCGCCAAAGACCTGCCCAGCGACGCG
CAGCTAGACGGCTATGATATCAGCAGCACGGTTTTCCCCAAGGCACCGTGGCAGCCGGCAAACATGCGGCTCATC
GAGGCCAATGCCCTTGAGCCGTTTGACGACGAGGTGTTGGGGAGCTATGATGTCGTTCATGTGCGGCTGATGGCC
TACTGCCTGGCCAGGGAGCAATGGCAGTTGTTGGCGAGGAATCTGGTGCCTCTTTTGCGGCCGGGAGGCTACATC
TTTTGGGAAGAGTGCGGATACCCGTGCATGACGTGCGTTCCCTTGACCAAGACTTTTCAGAAGGTTGCTGGCCTG
GATGCCCGATATGCAGCCAGCATGGGCAGAGATGTTACAATGCCCTCTGGTCTCTTGCGACACTTGCAAAACGCA
GGCTACACCGACCTTGGCCTGACAACCCATGACTCCTTCTCCCTGGGCGACTCGTTTCAAAAGTCGGCGCAGTAC
CTCATCATTTCAGCCTTGAAGCAGTCTATGCACGGCATCGTTGCCCTCGGGGGGTCTGAGTGGTTGCGCTCAGAC
GACGACGTTGAGCGCGCCGTGAAGCAACTGTACGCGGAAGCAGATGAGCTTGGCTGTCGGTACGGCTTCCAACTC
TATCACCTTGTCGGTCGAGCGCCGCAGTCTGAACGAGATGGCTAG
Gene >OphauG2|188
ATGAGGCCCATTGTTTATACCCTTGACAAGGGCGGCGTCCAGGACGACGAGGTCCAGCGGCTGAATGCCCAGCAC
CCCATCATAACGGCCGTTACAGGAAGCCTGATGCCGCACGTGGTGCGCAAGCACCTTGATGCCCTAGGCCGCCGG
CCGGCCGTGGCAGACATTGGCACGGGGACTGGCATCTGGCTACAGAGCATCGCCAAAGACCTGCCCAGCGACGCG
CAGCTAGACGGCTATGATATCAGCAGCACGGTTTTCCCCAAGGCACCGTGGCAGCCGGCAAACATGCGGCTCATC
GAGGCCAATGCCCTTGAGCCGTTTGACGACGAGGTGTTGGGGAGCTATGATGTCGTTCATGTGCGGCTGATGGCC
TACTGCCTGGCCAGGGAGCAATGGCAGTTGTTGGCGAGGAATCTGGTGCCTCTTTTGCGGCCGGGAGGCTACATC
TTTTGGGAAGAGTGCGGATACCCGTGCATGACGTGCGTTCCCTTGACCAAGACTTTTCAGAAGGTTGCTGGCCTG
GATGCCCGATATGCAGCCAGCATGGGCAGAGATGTTACGTATGTTTGGAGAATCAAGTCCAAGAGCGTCGTGGTT
GACTGAGTCTGTATACCGGCAGAATGCCCTCTGGTCTCTTGCGACACTTGCAAAACGCAGGCTACACCGACCTTG
GCCTGACAACCCATGACTCCTTCTCCCTGGGCGACTCGTTTCAAAAGTCGGCGCAGTACCTCATCATTTCAGCCT
TGAAGCAGTCTATGCACGGCATCGTTGCCCTCGGGGGGTCTGAGTGGTTGCGCTCAGACGACGACGTTGAGCGCG
CCGTGAAGCAACTGTACGCGGAAGCAGATGAGCTTGGCTGTCGGTACGGCTTCCAACTCTATCACCTTGTCGGTC
GAGCGCCGCAGTCTGAACGAGATGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail