Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1878
Gene name
LocationContig_160:3169..4874
Strand-
Gene length (bp)1705
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 2.8E-79 157 517
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 1.0E-06 55 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25345|SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM5 PE=1 SV=1 55 517 5.0E-102
sp|Q73P19|SYN_TREDE Asparagine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=asnS PE=3 SV=1 37 517 1.0E-101
sp|Q6ANL4|SYN_DESPS Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=asnS PE=3 SV=1 40 524 8.0E-100
sp|Q899M9|SYN_CLOTE Asparagine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=asnS PE=3 SV=1 54 523 3.0E-98
sp|Q9P6I0|SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm5 PE=3 SV=1 55 520 4.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25345|SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM5 PE=1 SV=1 55 517 5.0E-102
sp|Q73P19|SYN_TREDE Asparagine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=asnS PE=3 SV=1 37 517 1.0E-101
sp|Q6ANL4|SYN_DESPS Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=asnS PE=3 SV=1 40 524 8.0E-100
sp|Q899M9|SYN_CLOTE Asparagine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=asnS PE=3 SV=1 54 523 3.0E-98
sp|Q9P6I0|SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm5 PE=3 SV=1 55 520 4.0E-98
sp|P58692|SYN_NOSS1 Asparagine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=asnS PE=3 SV=1 57 517 1.0E-97
sp|B1XKH1|SYN_SYNP2 Asparagine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=asnS PE=3 SV=1 59 517 2.0E-97
sp|Q96I59|SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens GN=NARS2 PE=1 SV=3 20 522 5.0E-97
sp|A5N4F7|SYN_CLOK5 Asparagine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=asnS PE=3 SV=1 54 523 6.0E-97
sp|A7GB01|SYN_CLOBL Asparagine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=asnS PE=3 SV=1 55 523 6.0E-97
sp|Q8BGV0|SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus GN=Nars2 PE=1 SV=1 55 522 9.0E-97
sp|A5HZE1|SYN_CLOBH Asparagine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=asnS PE=3 SV=1 55 523 1.0E-96
sp|A7FRK8|SYN_CLOB1 Asparagine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=asnS PE=3 SV=1 55 523 1.0E-96
sp|Q317J6|SYN_DESAG Asparagine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=asnS PE=3 SV=1 43 517 3.0E-95
sp|Q817I8|SYN_BACCR Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=asnS PE=3 SV=1 55 523 6.0E-95
sp|Q6HCW9|SYN_BACHK Asparagine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=asnS PE=3 SV=1 55 523 1.0E-94
sp|Q633N6|SYN_BACCZ Asparagine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=asnS PE=3 SV=1 55 523 1.0E-94
sp|Q81L32|SYN_BACAN Asparagine--tRNA ligase OS=Bacillus anthracis GN=asnS PE=3 SV=1 55 523 1.0E-94
sp|P52276|SYN_SYNY3 Asparagine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=asnS PE=3 SV=2 55 517 1.0E-94
sp|A7GTK8|SYN_BACCN Asparagine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=asnS PE=3 SV=1 54 523 2.0E-94
sp|Q72ZI3|SYN_BACC1 Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=asnS PE=3 SV=1 55 523 2.0E-94
sp|B0JN99|SYN_MICAN Asparagine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=asnS PE=3 SV=1 54 517 3.0E-94
sp|Q72G53|SYN_DESVH Asparagine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=asnS PE=3 SV=1 53 523 7.0E-94
sp|A1V9B8|SYN_DESVV Asparagine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=asnS PE=3 SV=1 53 523 7.0E-94
sp|Q662R1|SYN_BORBP Asparagine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=asnS PE=3 SV=1 54 517 8.0E-94
sp|A3DBI2|SYN_CLOTH Asparagine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=asnS PE=3 SV=1 55 517 1.0E-93
sp|Q0SP63|SYN_BORAP Asparagine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=asnS PE=3 SV=1 54 517 2.0E-93
sp|O51128|SYN_BORBU Asparagine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=asnS PE=3 SV=2 54 517 4.0E-93
sp|A8MJ91|SYN_ALKOO Asparagine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=asnS PE=3 SV=1 55 517 7.0E-93
sp|Q11Q97|SYN_CYTH3 Asparagine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=asnS PE=3 SV=1 55 517 1.0E-92
sp|Q0SQ51|SYN_CLOPS Asparagine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=asnS PE=3 SV=1 40 523 2.0E-92
sp|P58693|SYN_CLOPE Asparagine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=asnS PE=3 SV=1 40 523 2.0E-92
sp|Q0TMF3|SYN_CLOP1 Asparagine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=asnS PE=3 SV=1 40 523 2.0E-92
sp|Q6MEC9|SYN_PARUW Asparagine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=asnS PE=3 SV=1 54 523 3.0E-92
sp|A0PY64|SYN_CLONN Asparagine--tRNA ligase OS=Clostridium novyi (strain NT) GN=asnS PE=3 SV=1 55 517 6.0E-92
sp|A6LPI6|SYN_CLOB8 Asparagine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=asnS PE=3 SV=1 55 517 9.0E-92
sp|A5G5R2|SYN_GEOUR Asparagine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=asnS PE=3 SV=1 45 517 1.0E-91
sp|Q023P9|SYN_SOLUE Asparagine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=asnS PE=3 SV=1 54 523 2.0E-91
sp|Q24MK1|SYN_DESHY Asparagine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=asnS PE=3 SV=1 55 523 2.0E-91
sp|Q8DG51|SYN_THEEB Asparagine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=asnS PE=3 SV=1 55 523 4.0E-91
sp|A0LL53|SYN_SYNFM Asparagine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=asnS PE=3 SV=1 37 523 5.0E-91
sp|B2UXS0|SYN_CLOBA Asparagine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=asnS PE=3 SV=1 55 523 1.0E-90
sp|B2TI01|SYN_CLOBB Asparagine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=asnS PE=3 SV=1 55 523 2.0E-90
sp|Q55FI3|SYNM_DICDI Probable asparagine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=asnS2 PE=3 SV=1 40 522 3.0E-90
sp|Q8PM16|SYN_XANAC Asparagine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=asnS PE=3 SV=1 55 523 5.0E-90
sp|Q74E08|SYN_GEOSL Asparagine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=asnS PE=3 SV=1 54 517 1.0E-89
sp|Q1DA04|SYN_MYXXD Asparagine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=asnS PE=3 SV=1 54 517 1.0E-89
sp|Q3BV23|SYN_XANC5 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=asnS PE=3 SV=1 55 523 2.0E-89
sp|Q3IGU4|SYN_PSEHT Asparagine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=asnS PE=3 SV=1 40 520 2.0E-89
sp|Q0HUL3|SYN_SHESR Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=asnS PE=3 SV=1 55 517 5.0E-89
sp|Q2SJV9|SYN_HAHCH Asparagine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=asnS PE=3 SV=1 38 517 5.0E-89
sp|Q6LPQ6|SYN_PHOPR Asparagine--tRNA ligase OS=Photobacterium profundum GN=asnS PE=3 SV=1 40 517 1.0E-88
sp|A0KXL6|SYN_SHESA Asparagine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=asnS PE=3 SV=1 55 517 1.0E-88
sp|Q8EEZ1|SYN_SHEON Asparagine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=asnS PE=3 SV=1 55 517 2.0E-88
sp|A6WMP4|SYN_SHEB8 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=asnS PE=3 SV=1 55 517 2.0E-88
sp|Q97E56|SYN_CLOAB Asparagine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=asnS PE=3 SV=1 55 523 2.0E-88
sp|A3D3V7|SYN_SHEB5 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=asnS PE=3 SV=1 55 517 2.0E-88
sp|Q8PAC4|SYN_XANCP Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=asnS PE=3 SV=1 55 523 2.0E-88
sp|Q4UTA1|SYN_XANC8 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=asnS PE=3 SV=1 55 523 2.0E-88
sp|Q0HIB6|SYN_SHESM Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=asnS PE=3 SV=1 55 517 2.0E-88
sp|Q5WUG0|SYN_LEGPL Asparagine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=asnS PE=3 SV=1 55 523 3.0E-88
sp|A9KZ30|SYN_SHEB9 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=asnS PE=3 SV=1 55 517 3.0E-88
sp|A6TVS9|SYN_ALKMQ Asparagine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=asnS PE=3 SV=1 54 517 3.0E-88
sp|Q8RH70|SYN_FUSNN Asparagine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=asnS PE=3 SV=1 39 517 5.0E-88
sp|A5IE87|SYN_LEGPC Asparagine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=asnS PE=3 SV=1 55 523 5.0E-88
sp|P75521|SYN_MYCPN Asparagine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=asnS PE=3 SV=1 40 523 6.0E-88
sp|Q87NH5|SYN_VIBPA Asparagine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=asnS PE=3 SV=1 40 517 8.0E-88
sp|P47359|SYN_MYCGE Asparagine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=asnS PE=3 SV=1 39 523 9.0E-88
sp|Q4A7W9|SYN_MYCH7 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=asnS PE=3 SV=1 55 517 1.0E-87
sp|Q600N9|SYN_MYCH2 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=asnS PE=3 SV=1 55 517 1.0E-87
sp|Q5X300|SYN_LEGPA Asparagine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=asnS PE=3 SV=1 55 523 2.0E-87
sp|Q2P326|SYN_XANOM Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=asnS PE=3 SV=1 55 523 2.0E-87
sp|Q9KSF9|SYN_VIBCH Asparagine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=asnS PE=3 SV=2 40 517 2.0E-87
sp|A8FVU8|SYN_SHESH Asparagine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=asnS PE=3 SV=1 55 517 2.0E-87
sp|Q6D453|SYN_PECAS Asparagine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=asnS PE=3 SV=1 55 517 2.0E-87
sp|Q4A9S1|SYN_MYCHJ Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=asnS PE=3 SV=1 55 517 2.0E-87
sp|Q12MT5|SYN_SHEDO Asparagine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=asnS PE=3 SV=1 55 517 2.0E-87
sp|Q5H049|SYN_XANOR Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=asnS PE=3 SV=1 55 523 3.0E-87
sp|Q081Q0|SYN_SHEFN Asparagine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=asnS PE=3 SV=1 55 517 6.0E-87
sp|A1RK52|SYN_SHESW Asparagine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=asnS PE=3 SV=1 54 517 8.0E-87
sp|A4Y6E4|SYN_SHEPC Asparagine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=asnS PE=3 SV=1 54 517 8.0E-87
sp|Q39SY7|SYN_GEOMG Asparagine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=asnS PE=3 SV=1 55 517 2.0E-86
sp|A6LIA1|SYN_PARD8 Asparagine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=asnS PE=3 SV=1 55 517 2.0E-86
sp|Q8EW03|SYN_MYCPE Asparagine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=asnS PE=3 SV=1 51 523 3.0E-86
sp|A1S684|SYN_SHEAM Asparagine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=asnS PE=3 SV=1 45 517 4.0E-86
sp|Q481G3|SYN_COLP3 Asparagine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=asnS PE=3 SV=1 37 517 5.0E-86
sp|Q7UHE1|SYN_RHOBA Asparagine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=asnS PE=3 SV=1 39 523 5.0E-86
sp|A3QE68|SYN_SHELP Asparagine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=asnS PE=3 SV=1 55 517 1.0E-85
sp|A1APP8|SYN_PELPD Asparagine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=asnS PE=3 SV=1 57 517 1.0E-85
sp|Q5QZ13|SYN_IDILO Asparagine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=asnS PE=3 SV=1 39 517 4.0E-85
sp|A6VNV7|SYN_ACTSZ Asparagine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=asnS PE=3 SV=1 37 517 4.0E-85
sp|P58694|SYN_ECO57 Asparagine--tRNA ligase OS=Escherichia coli O157:H7 GN=asnS PE=3 SV=2 40 517 5.0E-85
sp|Q9CN06|SYN_PASMU Asparagine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=asnS PE=3 SV=2 55 517 7.0E-85
sp|B2S3J9|SYN_TREPS Asparagine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=asnS PE=3 SV=1 57 517 7.0E-85
sp|O83618|SYN_TREPA Asparagine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=asnS PE=3 SV=1 57 517 7.0E-85
sp|Q1MQG9|SYN_LAWIP Asparagine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=asnS PE=3 SV=1 36 517 8.0E-85
sp|B3PNG8|SYN_MYCA5 Asparagine--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=asnS PE=3 SV=1 56 520 1.0E-84
sp|Q3Z3J0|SYN_SHISS Asparagine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|P0A8M2|SYN_SHIFL Asparagine--tRNA ligase OS=Shigella flexneri GN=asnS PE=3 SV=2 40 517 2.0E-84
sp|Q0T6B1|SYN_SHIF8 Asparagine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|Q31YR7|SYN_SHIBS Asparagine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|Q1RDS7|SYN_ECOUT Asparagine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|P0A8M0|SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) GN=asnS PE=1 SV=2 40 517 2.0E-84
sp|B1IW01|SYN_ECOLC Asparagine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|P0A8M1|SYN_ECOL6 Asparagine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=asnS PE=3 SV=2 40 517 2.0E-84
sp|Q0TJC3|SYN_ECOL5 Asparagine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|A7ZYN3|SYN_ECOHS Asparagine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|A7ZK21|SYN_ECO24 Asparagine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=asnS PE=3 SV=1 40 517 2.0E-84
sp|Q66CG7|SYN_YERPS Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=asnS PE=3 SV=1 55 517 2.0E-84
sp|A4TMZ6|SYN_YERPP Asparagine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=asnS PE=3 SV=1 55 517 2.0E-84
sp|Q1CGI7|SYN_YERPN Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=asnS PE=3 SV=1 55 517 2.0E-84
sp|P58697|SYN_YERPE Asparagine--tRNA ligase OS=Yersinia pestis GN=asnS PE=3 SV=1 55 517 2.0E-84
sp|Q1CA47|SYN_YERPA Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=asnS PE=3 SV=1 55 517 2.0E-84
sp|A7FJU5|SYN_YERP3 Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=asnS PE=3 SV=1 55 517 2.0E-84
sp|Q64P24|SYN_BACFR Asparagine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=asnS PE=3 SV=1 55 517 3.0E-84
sp|Q7MJS0|SYN_VIBVY Asparagine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=asnS PE=3 SV=1 40 517 3.0E-84
sp|Q8DAF0|SYN_VIBVU Asparagine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=asnS PE=3 SV=1 40 517 3.0E-84
sp|A8GCJ5|SYN_SERP5 Asparagine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=asnS PE=3 SV=1 55 517 3.0E-84
sp|A1JMN8|SYN_YERE8 Asparagine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=asnS PE=3 SV=1 55 517 3.0E-84
sp|A5UF16|SYN_HAEIG Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=asnS PE=3 SV=1 55 517 3.0E-84
sp|B0TUU1|SYN_SHEHH Asparagine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=asnS PE=3 SV=1 55 517 4.0E-84
sp|Q7N622|SYN_PHOLL Asparagine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=asnS PE=3 SV=1 40 517 4.0E-84
sp|A8H467|SYN_SHEPA Asparagine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=asnS PE=3 SV=1 55 517 4.0E-84
sp|A6L0U5|SYN_BACV8 Asparagine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=asnS PE=3 SV=1 55 517 4.0E-84
sp|Q32E51|SYN_SHIDS Asparagine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=asnS PE=3 SV=1 40 517 4.0E-84
sp|Q5E5P2|SYN_VIBF1 Asparagine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=asnS PE=3 SV=1 40 517 7.0E-84
sp|P57441|SYN_BUCAI Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=asnS PE=3 SV=1 55 517 9.0E-84
sp|A1SW33|SYN_PSYIN Asparagine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=asnS PE=3 SV=1 55 523 1.0E-83
sp|O48593|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYNO PE=2 SV=3 15 517 1.0E-83
sp|A5UCB9|SYN_HAEIE Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=asnS PE=3 SV=1 55 517 2.0E-83
sp|A0KIC3|SYN_AERHH Asparagine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=asnS PE=3 SV=1 57 517 2.0E-83
sp|Q5L8W2|SYN_BACFN Asparagine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=asnS PE=3 SV=1 55 517 2.0E-83
sp|A4W8U9|SYN_ENT38 Asparagine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=asnS PE=3 SV=1 40 517 3.0E-83
sp|P43829|SYN_HAEIN Asparagine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=asnS PE=3 SV=2 55 517 3.0E-83
sp|B3R0I1|SYN_PHYMT Asparagine--tRNA ligase OS=Phytoplasma mali (strain AT) GN=asnS PE=3 SV=1 37 516 3.0E-83
sp|Q57QZ8|SYN_SALCH Asparagine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=asnS PE=3 SV=1 40 517 4.0E-83
sp|Q8A0Z8|SYN_BACTN Asparagine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=asnS PE=3 SV=1 55 517 4.0E-83
sp|Q56112|SYN_SALTI Asparagine--tRNA ligase OS=Salmonella typhi GN=asnS PE=3 SV=3 40 517 8.0E-83
sp|Q5PGF0|SYN_SALPA Asparagine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=asnS PE=3 SV=1 40 517 8.0E-83
sp|P58696|SYN_SALTY Asparagine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=asnS PE=3 SV=2 40 517 1.0E-82
sp|B0UTU8|SYN_HISS2 Asparagine--tRNA ligase OS=Histophilus somni (strain 2336) GN=asnS PE=3 SV=1 37 517 1.0E-82
sp|B1V8X4|SYN_PHYAS Asparagine--tRNA ligase OS=Phytoplasma australiense GN=asnS PE=3 SV=1 57 519 1.0E-82
sp|Q0I2M9|SYN_HAES1 Asparagine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=asnS PE=3 SV=1 37 517 2.0E-82
sp|A9NE58|SYN_ACHLI Asparagine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=asnS PE=3 SV=1 55 517 4.0E-82
sp|Q1LT63|SYN_BAUCH Asparagine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=asnS PE=3 SV=1 55 518 4.0E-82
sp|A6T726|SYN_KLEP7 Asparagine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=asnS PE=3 SV=1 40 517 5.0E-82
sp|Q9PAF5|SYN_XYLFA Asparagine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=asnS PE=3 SV=1 54 517 7.0E-82
sp|Q2NU85|SYN_SODGM Asparagine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=asnS PE=3 SV=1 40 517 9.0E-82
sp|B3H198|SYN_ACTP7 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=asnS PE=3 SV=1 55 517 1.0E-81
sp|A3N039|SYN_ACTP2 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=asnS PE=3 SV=1 55 517 1.0E-81
sp|Q7VLL7|SYN_HAEDU Asparagine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=asnS PE=3 SV=1 54 517 1.0E-81
sp|Q87A82|SYN_XYLFT Asparagine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=asnS PE=3 SV=1 54 523 2.0E-81
sp|B0BNV4|SYN_ACTPJ Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=asnS PE=3 SV=1 55 517 3.0E-81
sp|Q65TR1|SYN_MANSM Asparagine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=asnS PE=3 SV=1 54 517 6.0E-81
sp|B8F3Y5|SYN_HAEPS Asparagine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=asnS PE=3 SV=1 55 517 1.0E-80
sp|Q6MUF2|SYN_MYCMS Asparagine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=asnS PE=3 SV=1 55 517 2.0E-80
sp|Q8K9I7|SYN_BUCAP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=asnS PE=3 SV=1 39 523 5.0E-80
sp|Q15UN9|SYN_PSEA6 Asparagine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=asnS PE=3 SV=1 40 523 7.0E-80
sp|B5ZBH7|SYN_UREU1 Asparagine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=asnS PE=3 SV=1 36 523 1.0E-79
sp|B6YRL1|SYN_AZOPC Asparagine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=asnS PE=3 SV=1 54 517 2.0E-79
sp|B2RK42|SYN_PORG3 Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=asnS PE=3 SV=1 55 517 6.0E-79
sp|Q7MVE5|SYN_PORGI Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=asnS PE=3 SV=1 55 517 6.0E-79
sp|Q2SR42|SYN_MYCCT Asparagine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=asnS PE=3 SV=1 55 517 7.0E-79
sp|Q9PQC6|SYN_UREPA Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=asnS PE=3 SV=1 55 523 1.0E-78
sp|B1AJ04|SYN_UREP2 Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=asnS PE=3 SV=1 55 523 1.0E-78
sp|Q6KHD7|SYN_MYCMO Asparagine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=asnS PE=3 SV=1 39 517 2.0E-78
sp|Q6YPH3|SYN_ONYPE Asparagine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=asnS PE=3 SV=1 55 519 8.0E-78
sp|Q98PF2|SYN_MYCPU Asparagine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=asnS PE=3 SV=1 49 517 8.0E-78
sp|Q7VR09|SYN_BLOFL Asparagine--tRNA ligase OS=Blochmannia floridanus GN=asnS PE=3 SV=1 37 517 1.0E-77
sp|Q492P3|SYN_BLOPB Asparagine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=asnS PE=3 SV=1 39 517 2.0E-77
sp|Q8D2U1|SYN_WIGBR Asparagine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=asnS PE=3 SV=1 55 517 1.0E-75
sp|P59517|SYN_BUCBP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=asnS PE=3 SV=1 39 523 2.0E-75
sp|Q2NIF5|SYN_AYWBP Asparagine--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=asnS PE=3 SV=1 59 519 3.0E-75
sp|Q6F0Y5|SYN_MESFL Asparagine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=asnS PE=3 SV=1 55 517 4.0E-75
sp|Q7NBM9|SYN_MYCGA Asparagine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=asnS PE=3 SV=2 40 523 6.0E-73
sp|Q6G9A8|SYN_STAAS Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=asnS PE=3 SV=1 54 522 1.0E-65
sp|Q6GGV5|SYN_STAAR Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=asnS PE=3 SV=1 54 522 2.0E-65
sp|A4J412|SYN_DESRM Asparagine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=asnS PE=3 SV=1 54 522 2.0E-65
sp|Q8NWP3|SYN_STAAW Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|A8Z434|SYN_STAAT Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|A6QH05|SYN_STAAE Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|Q5HFW9|SYN_STAAC Asparagine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|Q2FYH6|SYN_STAA8 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|Q2FGY6|SYN_STAA3 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|P67572|SYN_STAAN Asparagine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=asnS PE=1 SV=1 54 522 3.0E-65
sp|P67571|SYN_STAAM Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|A5ISY4|SYN_STAA9 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|A6U1S3|SYN_STAA2 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|A7X2E9|SYN_STAA1 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|Q2YY52|SYN_STAAB Asparagine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=asnS PE=3 SV=1 54 522 3.0E-65
sp|Q8EQE2|SYN_OCEIH Asparagine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=asnS PE=3 SV=1 55 522 1.0E-64
sp|A0AK01|SYN_LISW6 Asparagine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=asnS PE=3 SV=1 55 522 1.0E-64
sp|A7Z5Y7|SYN_BACMF Asparagine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=asnS PE=3 SV=1 54 522 2.0E-64
sp|P39772|SYN_BACSU Asparagine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=asnS PE=3 SV=2 54 522 2.0E-64
sp|P58695|SYN_LISMO Asparagine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=asnS PE=3 SV=1 54 522 4.0E-64
sp|Q71YB9|SYN_LISMF Asparagine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=asnS PE=3 SV=1 55 522 9.0E-64
sp|Q92AB2|SYN_LISIN Asparagine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=asnS PE=3 SV=1 55 522 1.0E-63
sp|Q5WGB1|SYN_BACSK Asparagine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=asnS PE=3 SV=1 54 522 2.0E-63
sp|Q65I63|SYN_BACLD Asparagine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=asnS PE=3 SV=1 54 522 2.0E-62
sp|Q38X65|SYN_LACSS Asparagine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=asnS PE=3 SV=1 54 522 3.0E-60
sp|Q8CSI9|SYN_STAES Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=asnS PE=3 SV=1 55 522 4.0E-60
sp|Q5HP89|SYN_STAEQ Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=asnS PE=3 SV=1 55 522 4.0E-60
sp|B9LCU8|SYN_CHLSY Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=asnS PE=3 SV=1 36 522 1.0E-59
sp|A9WA97|SYN_CHLAA Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=asnS PE=3 SV=1 36 522 1.0E-59
sp|Q050D9|SYN_LEPBL Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=asnS PE=3 SV=1 54 522 2.0E-59
sp|Q04SB3|SYN_LEPBJ Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=asnS PE=3 SV=1 54 522 2.0E-59
sp|Q038W1|SYN_LACC3 Asparagine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=asnS PE=3 SV=1 54 521 2.0E-59
sp|Q4L6F8|SYN_STAHJ Asparagine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=asnS PE=3 SV=1 55 522 3.0E-59
sp|A5D2C2|SYN_PELTS Asparagine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=asnS PE=3 SV=1 54 517 4.0E-59
sp|B8GBG7|SYN_CHLAD Asparagine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=asnS PE=3 SV=1 36 522 5.0E-59
sp|Q9KC78|SYN_BACHD Asparagine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=asnS PE=3 SV=1 54 522 1.0E-58
sp|Q49XR0|SYN_STAS1 Asparagine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=asnS PE=3 SV=1 55 522 2.0E-58
sp|Q831X4|SYN_ENTFA Asparagine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=asnS PE=3 SV=1 55 522 3.0E-58
sp|Q88WA8|SYN2_LACPL Asparagine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS2 PE=3 SV=1 54 522 4.0E-58
sp|Q72QT4|SYN_LEPIC Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=asnS PE=3 SV=1 54 522 6.0E-58
sp|A9GBR2|SYN_SORC5 Asparagine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=asnS PE=3 SV=1 43 521 7.0E-58
sp|Q8F522|SYN_LEPIN Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=asnS PE=3 SV=1 54 522 8.0E-58
sp|A4IQ54|SYN_GEOTN Asparagine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=asnS PE=3 SV=1 54 522 1.0E-57
sp|A9AYM5|SYN_HERA2 Asparagine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=asnS PE=3 SV=1 55 521 1.0E-57
sp|Q8CWQ4|SYN_STRR6 Asparagine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=asnS PE=3 SV=1 55 522 2.0E-57
sp|Q04JK7|SYN_STRP2 Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=asnS PE=3 SV=1 55 522 2.0E-57
sp|Q97PR0|SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=asnS PE=1 SV=1 55 522 3.0E-57
sp|Q1WU36|SYN_LACS1 Asparagine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=asnS PE=3 SV=1 54 522 5.0E-57
sp|A3CNM0|SYN_STRSV Asparagine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=asnS PE=3 SV=1 51 522 6.0E-57
sp|Q5M067|SYN_STRT1 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=asnS PE=3 SV=1 51 522 3.0E-56
sp|B2GA02|SYN_LACRJ Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=asnS PE=3 SV=1 54 523 5.0E-56
sp|A5VMP9|SYN_LACRD Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=asnS PE=3 SV=1 54 523 5.0E-56
sp|Q1IHQ3|SYN_KORVE Asparagine--tRNA ligase OS=Koribacter versatilis (strain Ellin345) GN=asnS PE=3 SV=1 36 522 5.0E-56
sp|Q5M4S8|SYN_STRT2 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=asnS PE=3 SV=1 51 522 6.0E-56
sp|Q03L20|SYN_STRTD Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=asnS PE=3 SV=1 51 522 8.0E-56
sp|A2RMQ1|SYN_LACLM Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=asnS PE=3 SV=1 55 522 2.0E-55
sp|Q04EX6|SYN_OENOB Asparagine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=asnS PE=3 SV=1 54 522 2.0E-55
sp|Q19722|SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=nrs-1 PE=3 SV=1 55 522 2.0E-55
sp|A4W083|SYN_STRS2 Asparagine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=asnS PE=3 SV=1 55 517 2.0E-54
sp|P0DG29|SYN_STRPQ Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|Q48UH6|SYN_STRPM Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|A2RFM5|SYN_STRPG Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|Q1JHS6|SYN_STRPD Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|P67577|SYN_STRP8 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|P0DG28|SYN_STRP3 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|P67575|SYN_STRP1 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|Q1JMN3|SYN_STRPC Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|Q1JCQ7|SYN_STRPB Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|Q02X21|SYN_LACLS Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|Q5XD20|SYN_STRP6 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=asnS PE=3 SV=1 55 522 2.0E-54
sp|P67574|SYN_STRA5 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=asnS PE=3 SV=1 55 522 3.0E-54
sp|P67573|SYN_STRA3 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=asnS PE=3 SV=1 55 522 3.0E-54
sp|Q3K2E5|SYN_STRA1 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=asnS PE=3 SV=1 55 522 3.0E-54
sp|Q9CEK9|SYN_LACLA Asparagine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=asnS PE=3 SV=1 55 522 5.0E-54
sp|Q1J7K5|SYN_STRPF Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=asnS PE=3 SV=1 55 522 1.0E-53
sp|Q979Y4|SYN_THEVO Asparagine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=asnS PE=3 SV=1 43 517 2.0E-53
sp|A7NHQ4|SYN_ROSCS Asparagine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=asnS PE=3 SV=1 36 517 2.0E-53
sp|Q67P26|SYN_SYMTH Asparagine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=asnS PE=3 SV=1 54 522 4.0E-53
sp|A4VTZ1|SYN_STRSY Asparagine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=asnS PE=3 SV=1 55 516 6.0E-53
sp|Q9SW96|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana GN=SYNC1 PE=1 SV=1 220 523 2.0E-52
sp|A5UPW5|SYN_ROSS1 Asparagine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=asnS PE=3 SV=1 36 517 3.0E-52
sp|P54262|SYN_LACDA Asparagine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=asnS1 PE=3 SV=1 60 522 4.0E-52
sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=1 SV=1 220 523 5.0E-52
sp|C4V847|SYNC_NOSCE Probable asparagine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100652 PE=3 SV=1 55 522 2.0E-51
sp|Q8DTM2|SYN_STRMU Asparagine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=asnS PE=3 SV=1 55 523 2.0E-51
sp|Q88Y40|SYN1_LACPL Asparagine--tRNA ligase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS1 PE=3 SV=1 54 522 3.0E-51
sp|Q9V251|SYN_PYRAB Asparagine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=asnS PE=3 SV=1 49 522 3.0E-51
sp|C5A4R8|SYN_THEGJ Asparagine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=asnS PE=3 SV=1 49 517 6.0E-51
sp|O57980|SYN_PYRHO Asparagine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=asnS PE=1 SV=1 49 522 6.0E-51
sp|A8YVJ7|SYN_LACH4 Asparagine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=asnS PE=3 SV=1 55 522 2.0E-50
sp|Q8U4D3|SYN_PYRFU Asparagine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=asnS PE=3 SV=2 49 522 2.0E-50
sp|Q043G9|SYN_LACGA Asparagine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=asnS PE=3 SV=1 55 522 4.0E-50
sp|Q74JA9|SYN_LACJO Asparagine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=asnS PE=3 SV=1 55 522 4.0E-50
sp|Q554D9|SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=asnS1 PE=1 SV=1 55 521 2.0E-49
sp|Q9HKS7|SYN_THEAC Asparagine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=asnS PE=3 SV=1 54 517 2.0E-49
sp|Q8SQK8|SYNC_ENCCU Probable asparagine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_1680 PE=3 SV=2 54 522 2.0E-49
sp|P54263|SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=asnS PE=1 SV=2 54 522 5.0E-49
sp|C1CV26|SYN_DEIDV Asparagine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=asnS PE=3 SV=1 54 522 8.0E-49
sp|A9CTP8|SYNC_ENTBH Probable asparagine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22533 PE=3 SV=1 47 522 1.0E-48
sp|Q5JHC1|SYN_THEKO Asparagine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=asnS PE=3 SV=1 49 517 1.0E-48
sp|P38707|SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1 55 522 3.0E-48
sp|Q1IZA1|SYN_DEIGD Asparagine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=asnS PE=3 SV=1 54 522 5.0E-48
sp|Q72KF7|SYN_THET2 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=asnS PE=3 SV=1 54 522 6.0E-48
sp|Q6BU46|SYNC_DEBHA Asparagine--tRNA ligase, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED81 PE=3 SV=1 55 522 6.0E-47
sp|O94567|SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrs1 PE=3 SV=1 55 522 6.0E-46
sp|O58776|SYD_PYRHO Aspartate--tRNA(Asp) ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspS PE=3 SV=1 49 517 2.0E-44
sp|Q9V036|SYD_PYRAB Aspartate--tRNA(Asp) ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspS PE=3 SV=1 49 517 3.0E-44
sp|Q8U2G6|SYD_PYRFU Aspartate--tRNA(Asp) ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=aspS PE=3 SV=1 55 522 8.0E-43
sp|Q52428|SYD_THEKO Aspartate--tRNA(Asp) ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspS PE=1 SV=2 54 517 9.0E-42
sp|Q8BP47|SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Nars PE=1 SV=2 55 522 2.0E-41
sp|Q2KJG3|SYNC_BOVIN Asparagine--tRNA ligase, cytoplasmic OS=Bos taurus GN=NARS PE=2 SV=3 55 522 3.0E-41
sp|Q9SW95|SYNC2_ARATH Asparagine--tRNA ligase, cytoplasmic 2 OS=Arabidopsis thaliana GN=SYNC2 PE=1 SV=2 220 523 5.0E-41
sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1 55 522 6.0E-41
sp|Q9Y9U7|SYDND_AERPE Aspartate--tRNA(Asp/Asn) ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aspS PE=3 SV=2 40 522 2.0E-40
sp|Q4R4Z1|SYNC_MACFA Asparagine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=NARS PE=2 SV=1 55 522 5.0E-40
sp|Q8TXG4|SYDND_METKA Aspartate--tRNA(Asp/Asn) ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aspS PE=3 SV=1 49 522 1.0E-39
sp|Q8ZYM8|SYD_PYRAE Aspartate--tRNA(Asp) ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aspS PE=1 SV=1 55 523 2.0E-39
sp|Q5SIC2|SYDND_THET8 Aspartate--tRNA(Asp/Asn) ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspS2 PE=1 SV=1 47 517 5.0E-39
sp|P10723|SYNC_BRUMA Asparagine--tRNA ligase, cytoplasmic OS=Brugia malayi PE=1 SV=1 54 522 8.0E-39
sp|O07683|SYDND_HALSA Aspartate--tRNA(Asp/Asn) ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=aspS PE=1 SV=1 51 517 1.0E-36
sp|Q5V1N2|SYDND_HALMA Aspartate--tRNA(Asp/Asn) ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=aspS PE=3 SV=1 55 522 7.0E-36
sp|Q6KZQ3|SYD_PICTO Aspartate--tRNA(Asp) ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=aspS PE=3 SV=1 50 522 9.0E-36
sp|Q9RVH4|SYDND_DEIRA Aspartate--tRNA(Asp/Asn) ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aspS2 PE=1 SV=1 54 517 2.0E-35
sp|Q2FRU5|SYDND_METHJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=aspS PE=3 SV=1 46 522 6.0E-35
sp|Q58950|SYDND_METJA Aspartate--tRNA(Asp/Asn) ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aspS PE=3 SV=1 38 522 7.0E-35
sp|Q3IT59|SYDND_NATPD Aspartate--tRNA(Asp/Asn) ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=aspS PE=3 SV=1 55 522 2.0E-34
sp|O29342|SYDND_ARCFU Aspartate--tRNA(Asp/Asn) ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aspS PE=3 SV=1 49 522 4.0E-34
sp|Q976I3|SYDND_SULTO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspS PE=1 SV=1 38 522 4.0E-34
sp|Q2NHT0|SYDND_METST Aspartate--tRNA(Asp/Asn) ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aspS PE=3 SV=1 55 517 2.0E-33
sp|A6UQQ8|SYDND_METVS Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=aspS PE=3 SV=1 49 522 2.0E-32
sp|Q18KP5|SYDND_HALWD Aspartate--tRNA(Asp/Asn) ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=aspS PE=3 SV=1 55 522 3.0E-32
sp|Q980V3|SYDND_SULSO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspS PE=3 SV=1 38 522 3.0E-31
sp|O24822|SYDND_HALVO Aspartate--tRNA(Asp/Asn) ligase OS=Haloferax volcanii GN=aspS PE=3 SV=2 54 522 4.0E-31
sp|A9A945|SYDND_METM6 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=aspS PE=3 SV=1 49 522 2.0E-30
sp|A6VHK5|SYDND_METM7 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=aspS PE=3 SV=1 49 522 2.0E-30
sp|O26328|SYDND_METTH Aspartate--tRNA(Asp/Asn) ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aspS PE=1 SV=1 49 517 1.0E-29
sp|Q6LWU0|SYDND_METMP Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=aspS PE=3 SV=1 49 522 1.0E-29
sp|A4G0V5|SYDND_METM5 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=aspS PE=3 SV=1 49 522 2.0E-29
sp|A6USZ9|SYDND_META3 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=aspS PE=3 SV=1 47 521 2.0E-29
sp|Q9HJM1|SYD_THEAC Aspartate--tRNA(Asp) ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=aspS PE=3 SV=1 51 522 1.0E-27
sp|A3CXH4|SYDND_METMJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=aspS PE=3 SV=1 54 521 3.0E-27
sp|A2SPG1|SYDND_METLZ Aspartate--tRNA(Asp/Asn) ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=aspS PE=3 SV=1 46 522 3.0E-27
sp|Q979P6|SYD_THEVO Aspartate--tRNA(Asp) ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=aspS PE=3 SV=1 54 522 4.0E-26
sp|Q12XU7|SYDND_METBU Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=aspS PE=3 SV=1 54 521 5.0E-26
sp|P04802|SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPS1 PE=1 SV=3 165 517 7.0E-26
sp|Q8H104|SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana GN=At4g26870 PE=2 SV=1 166 521 2.0E-25
sp|Q8Q0R2|SYDND_METMA Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aspS PE=1 SV=1 38 517 2.0E-25
sp|Q466Y5|SYDND_METBF Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=aspS PE=3 SV=1 38 517 5.0E-25
sp|Q8TQ68|SYDND_METAC Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aspS PE=3 SV=1 54 517 6.0E-25
sp|Q5R9I5|SYDC_PONAB Aspartate--tRNA ligase, cytoplasmic OS=Pongo abelii GN=DARS PE=2 SV=1 165 517 1.0E-24
sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus GN=Dars PE=1 SV=2 165 517 2.0E-24
sp|P15178|SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Dars PE=2 SV=1 165 517 7.0E-24
sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens GN=DARS PE=1 SV=2 165 517 4.0E-23
sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus GN=DARS PE=2 SV=1 128 517 9.0E-23
sp|Q75JQ1|SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum GN=aspS1 PE=3 SV=1 163 517 1.0E-22
sp|Q03577|SYDC_CAEEL Aspartate--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=drs-1 PE=3 SV=1 40 517 4.0E-22
sp|A1S6P2|SYD_SHEAM Aspartate--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=aspS PE=3 SV=1 55 517 3.0E-21
sp|B7XHQ4|SYDC_ENTBH Probable aspartate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21705 PE=3 SV=1 163 517 3.0E-21
sp|Q9M084|SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana GN=IBI1 PE=1 SV=1 40 517 5.0E-21
sp|O74407|SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 163 517 1.0E-20
sp|Q5QYV2|SYD_IDILO Aspartate--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=aspS PE=3 SV=1 47 517 1.0E-20
sp|Q7MJ74|SYD_VIBVY Aspartate--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=aspS PE=3 SV=1 55 517 1.0E-20
sp|Q8DAN7|SYD_VIBVU Aspartate--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=aspS PE=3 SV=1 55 517 1.0E-20
sp|Q3IIN7|SYD_PSEHT Aspartate--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=aspS PE=3 SV=1 55 517 2.0E-20
sp|Q7MB41|SYD_PHOLL Aspartate--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aspS PE=3 SV=1 47 517 3.0E-20
sp|Q87QV2|SYD_VIBPA Aspartate--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=aspS PE=3 SV=1 55 517 7.0E-20
sp|P59422|SYD_BUCBP Aspartate--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=aspS PE=3 SV=1 55 517 1.0E-19
sp|Q081N5|SYD_SHEFN Aspartate--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=aspS PE=3 SV=1 38 517 1.0E-19
sp|Q57N96|SYD_SALCH Aspartate--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=aspS PE=3 SV=1 55 517 2.0E-19
sp|A7N1J1|SYD_VIBCB Aspartate--tRNA ligase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=aspS PE=3 SV=1 55 517 2.0E-19
sp|A7MEB6|SYD_CROS8 Aspartate--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aspS PE=3 SV=1 55 517 3.0E-19
sp|A8H549|SYD_SHEPA Aspartate--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=aspS PE=3 SV=1 55 517 3.0E-19
sp|A6VXD0|SYDND_MARMS Aspartate--tRNA(Asp/Asn) ligase OS=Marinomonas sp. (strain MWYL1) GN=aspS PE=3 SV=1 38 517 3.0E-19
sp|B7VMI0|SYD_VIBTL Aspartate--tRNA ligase OS=Vibrio tasmaniensis (strain LGP32) GN=aspS PE=3 SV=1 55 517 3.0E-19
sp|A4WBM3|SYD_ENT38 Aspartate--tRNA ligase OS=Enterobacter sp. (strain 638) GN=aspS PE=3 SV=1 55 517 4.0E-19
sp|A3QEP7|SYD_SHELP Aspartate--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=aspS PE=3 SV=1 55 517 4.0E-19
sp|B6EGJ1|SYD_ALISL Aspartate--tRNA ligase OS=Aliivibrio salmonicida (strain LFI1238) GN=aspS PE=3 SV=1 55 517 4.0E-19
sp|C0Q2E8|SYD_SALPC Aspartate--tRNA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=aspS PE=3 SV=1 55 517 5.0E-19
sp|A1JRL1|SYD_YERE8 Aspartate--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aspS PE=3 SV=1 55 517 6.0E-19
sp|Q8EEE9|SYD_SHEON Aspartate--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=aspS PE=3 SV=1 38 517 7.0E-19
sp|Q6LT53|SYD_PHOPR Aspartate--tRNA ligase OS=Photobacterium profundum GN=aspS PE=3 SV=1 55 517 9.0E-19
sp|B4ETP3|SYD_PROMH Aspartate--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=aspS PE=3 SV=1 55 517 1.0E-18
sp|B5F3I9|SYD_SALA4 Aspartate--tRNA ligase OS=Salmonella agona (strain SL483) GN=aspS PE=3 SV=1 55 517 1.0E-18
sp|Q0HIZ5|SYD_SHESM Aspartate--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=aspS PE=3 SV=1 38 517 1.0E-18
sp|B0BQ90|SYD_ACTPJ Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=aspS PE=3 SV=1 55 517 1.0E-18
sp|A3N1F3|SYD_ACTP2 Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=aspS PE=3 SV=1 55 517 1.0E-18
sp|A0KWL5|SYD_SHESA Aspartate--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=aspS PE=3 SV=1 38 517 2.0E-18
sp|A5UAG7|SYD_HAEIE Aspartate--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=aspS PE=3 SV=1 38 517 2.0E-18
sp|B3GY37|SYD_ACTP7 Aspartate--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B4T7Z9|SYD_SALHS Aspartate--tRNA ligase OS=Salmonella heidelberg (strain SL476) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B5R8D6|SYD_SALG2 Aspartate--tRNA ligase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B5R1V2|SYD_SALEP Aspartate--tRNA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B5FSN0|SYD_SALDC Aspartate--tRNA ligase OS=Salmonella dublin (strain CT_02021853) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B0VRC7|SYDND_ACIBS Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baumannii (strain SDF) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B5BH54|SYD_SALPK Aspartate--tRNA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|Q5PMZ6|SYD_SALPA Aspartate--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B4TYS4|SYD_SALSV Aspartate--tRNA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|A9MUB9|SYD_SALPB Aspartate--tRNA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|B4SVF1|SYD_SALNS Aspartate--tRNA ligase OS=Salmonella newport (strain SL254) GN=aspS PE=3 SV=1 55 517 2.0E-18
sp|Q0HUY7|SYD_SHESR Aspartate--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=aspS PE=3 SV=1 38 517 2.0E-18
sp|P43817|SYD_HAEIN Aspartate--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=aspS PE=3 SV=1 38 517 2.0E-18
sp|A8AFH5|SYD_CITK8 Aspartate--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aspS PE=3 SV=1 55 517 3.0E-18
sp|Q8ZNV2|SYD_SALTY Aspartate--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aspS PE=3 SV=1 55 517 4.0E-18
sp|A8FUW6|SYD_SHESH Aspartate--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=aspS PE=3 SV=1 55 517 4.0E-18
sp|A5UGD3|SYD_HAEIG Aspartate--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=aspS PE=3 SV=1 38 517 4.0E-18
sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=1 SV=1 54 215 5.0E-18
sp|A4Y6S5|SYD_SHEPC Aspartate--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=aspS PE=3 SV=1 38 517 5.0E-18
sp|Q21MA4|SYDND_SACD2 Aspartate--tRNA(Asp/Asn) ligase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=aspS PE=3 SV=1 55 517 6.0E-18
sp|Q15RN2|SYDND_PSEA6 Aspartate--tRNA(Asp/Asn) ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=aspS PE=3 SV=1 55 517 6.0E-18
sp|B0V550|SYDND_ACIBY Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baumannii (strain AYE) GN=aspS PE=3 SV=1 54 517 6.0E-18
sp|B2HYL7|SYDND_ACIBC Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baumannii (strain ACICU) GN=aspS PE=3 SV=1 54 517 6.0E-18
sp|B7I8M5|SYDND_ACIB5 Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baumannii (strain AB0057) GN=aspS PE=3 SV=1 54 517 6.0E-18
sp|B7GWN1|SYDND_ACIB3 Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baumannii (strain AB307-0294) GN=aspS PE=3 SV=1 54 517 6.0E-18
sp|Q6D497|SYD_PECAS Aspartate--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aspS PE=3 SV=1 55 517 6.0E-18
sp|Q31H87|SYDND_THICR Aspartate--tRNA(Asp/Asn) ligase OS=Thiomicrospira crunogena (strain XCL-2) GN=aspS PE=3 SV=1 55 517 6.0E-18
sp|Q8Z5W1|SYD_SALTI Aspartate--tRNA ligase OS=Salmonella typhi GN=aspS PE=3 SV=1 55 517 6.0E-18
sp|B0TSA3|SYD_SHEHH Aspartate--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=aspS PE=3 SV=1 55 517 8.0E-18
sp|A3M8Q6|SYDND_ACIBT Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=aspS PE=3 SV=2 54 517 9.0E-18
sp|A1RJQ6|SYD_SHESW Aspartate--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=aspS PE=3 SV=1 38 517 9.0E-18
sp|Q12N06|SYD_SHEDO Aspartate--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=aspS PE=3 SV=1 38 517 1.0E-17
sp|Q5E6A2|SYD_VIBF1 Aspartate--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=aspS PE=3 SV=1 55 517 1.0E-17
sp|B5EJL3|SYDND_ACIF5 Aspartate--tRNA(Asp/Asn) ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=aspS PE=3 SV=1 54 517 1.0E-17
sp|B7J3F7|SYDND_ACIF2 Aspartate--tRNA(Asp/Asn) ligase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=aspS PE=3 SV=1 54 517 1.0E-17
sp|A8GFJ2|SYD_SERP5 Aspartate--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=aspS PE=3 SV=1 55 517 1.0E-17
sp|B5FCP9|SYD_VIBFM Aspartate--tRNA ligase OS=Vibrio fischeri (strain MJ11) GN=aspS PE=3 SV=1 55 517 1.0E-17
sp|Q0VRK1|SYDND_ALCBS Aspartate--tRNA(Asp/Asn) ligase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=aspS PE=3 SV=1 38 517 2.0E-17
sp|Q8SRQ8|SYDC_ENCCU Probable aspartate--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0790 PE=3 SV=1 163 517 2.0E-17
sp|B2VJ90|SYD_ERWT9 Aspartate--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aspS PE=3 SV=1 55 517 2.0E-17
sp|P21889|SYD_ECOLI Aspartate--tRNA ligase OS=Escherichia coli (strain K12) GN=aspS PE=1 SV=1 55 517 2.0E-17
sp|A8A166|SYD_ECOHS Aspartate--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=aspS PE=3 SV=1 55 517 2.0E-17
sp|B1XHD4|SYD_ECODH Aspartate--tRNA ligase OS=Escherichia coli (strain K12 / DH10B) GN=aspS PE=3 SV=1 55 517 2.0E-17
sp|C4ZQF0|SYD_ECOBW Aspartate--tRNA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aspS PE=3 SV=1 55 517 2.0E-17
sp|B7USP3|SYD_ECO27 Aspartate--tRNA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aspS PE=3 SV=1 55 517 2.0E-17
sp|Q4QNM1|SYD_HAEI8 Aspartate--tRNA ligase OS=Haemophilus influenzae (strain 86-028NP) GN=aspS PE=3 SV=1 38 517 3.0E-17
sp|A9MND2|SYD_SALAR Aspartate--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|Q1RAR8|SYD_ECOUT Aspartate--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|Q8FGQ9|SYD_ECOL6 Aspartate--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|Q0TGW6|SYD_ECOL5 Aspartate--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|A1AC27|SYD_ECOK1 Aspartate--tRNA ligase OS=Escherichia coli O1:K1 / APEC GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|B7MVZ7|SYD_ECO81 Aspartate--tRNA ligase OS=Escherichia coli O81 (strain ED1a) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|B7MBS5|SYD_ECO45 Aspartate--tRNA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|C6DFE7|SYD_PECCP Aspartate--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|Q3Z2M4|SYD_SHISS Aspartate--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|C3LLL2|SYD_VIBCM Aspartate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|Q9KSU0|SYD_VIBCH Aspartate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|A5F263|SYD_VIBC3 Aspartate--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|Q8XCI7|SYD_ECO57 Aspartate--tRNA ligase OS=Escherichia coli O157:H7 GN=aspS PE=3 SV=1 55 517 3.0E-17
sp|B5YR11|SYD_ECO5E Aspartate--tRNA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aspS PE=3 SV=1 55 517 4.0E-17
sp|A1SST6|SYDND_PSYIN Aspartate--tRNA(Asp/Asn) ligase OS=Psychromonas ingrahamii (strain 37) GN=aspS PE=3 SV=1 55 517 4.0E-17
sp|B7LPH8|SYD_ESCF3 Aspartate--tRNA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aspS PE=3 SV=1 55 517 4.0E-17
sp|Q322D4|SYD_SHIBS Aspartate--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B2TXL2|SYD_SHIB3 Aspartate--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B1LD05|SYD_ECOSM Aspartate--tRNA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B6IBU5|SYD_ECOSE Aspartate--tRNA ligase OS=Escherichia coli (strain SE11) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B7NBL7|SYD_ECOLU Aspartate--tRNA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B1J0M2|SYD_ECOLC Aspartate--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B7M2F7|SYD_ECO8A Aspartate--tRNA ligase OS=Escherichia coli O8 (strain IAI1) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B7L7R9|SYD_ECO55 Aspartate--tRNA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|A7ZMZ0|SYD_ECO24 Aspartate--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|Q32H95|SYD_SHIDS Aspartate--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|B5XQ00|SYD_KLEP3 Aspartate--tRNA ligase OS=Klebsiella pneumoniae (strain 342) GN=aspS PE=3 SV=1 55 517 5.0E-17
sp|Q82SQ5|SYDND_NITEU Aspartate--tRNA(Asp/Asn) ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=aspS PE=3 SV=1 55 517 6.0E-17
sp|B7NS52|SYD_ECO7I Aspartate--tRNA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aspS PE=3 SV=1 55 517 8.0E-17
sp|Q2GHC9|SYDND_EHRCR Aspartate--tRNA(Asp/Asn) ligase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=aspS PE=3 SV=1 55 516 9.0E-17
sp|A3D477|SYD_SHEB5 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=aspS PE=3 SV=1 38 517 1.0E-16
sp|A4G778|SYK_HERAR Lysine--tRNA ligase OS=Herminiimonas arsenicoxydans GN=lysS PE=3 SV=1 18 523 1.0E-16
sp|Q6FEH6|SYDND_ACIAD Aspartate--tRNA(Asp/Asn) ligase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=aspS PE=3 SV=2 54 517 1.0E-16
sp|A6WNQ6|SYD_SHEB8 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS185) GN=aspS PE=3 SV=1 38 517 2.0E-16
sp|B8EA71|SYD_SHEB2 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS223) GN=aspS PE=3 SV=1 38 517 2.0E-16
sp|A9L3I1|SYD_SHEB9 Aspartate--tRNA ligase OS=Shewanella baltica (strain OS195) GN=aspS PE=3 SV=1 38 517 2.0E-16
sp|B8F789|SYD_HAEPS Aspartate--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=aspS PE=3 SV=1 55 517 3.0E-16
sp|Q0AIE4|SYDND_NITEC Aspartate--tRNA(Asp/Asn) ligase OS=Nitrosomonas eutropha (strain C91) GN=aspS PE=3 SV=1 54 517 4.0E-16
sp|A9IVI2|SYDND_BART1 Aspartate--tRNA(Asp/Asn) ligase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=aspS PE=3 SV=1 54 516 5.0E-16
sp|Q9ZLL9|SYDND_HELPJ Aspartate--tRNA(Asp/Asn) ligase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=aspS PE=3 SV=1 49 517 6.0E-16
sp|A0AF28|SYK_LISW6 Lysine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=lysS PE=3 SV=1 23 516 6.0E-16
sp|P41908|SYNC_SACPA Asparagine--tRNA ligase, cytoplasmic (Fragment) OS=Saccharomyces paradoxus GN=DED81 PE=3 SV=1 431 522 1.0E-15
sp|Q16B16|SYDND_ROSDO Aspartate--tRNA(Asp/Asn) ligase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=aspS PE=3 SV=1 38 311 2.0E-15
sp|Q7VLU5|SYK_HAEDU Lysine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lysS PE=3 SV=1 41 518 3.0E-15
sp|B1KHG7|SYD_SHEWM Aspartate--tRNA ligase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=aspS PE=3 SV=1 55 517 4.0E-15
sp|Q8YAB8|SYK_LISMO Lysine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lysS PE=3 SV=1 23 516 4.0E-15
sp|Q318C3|SYK_PROM9 Lysine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=lysS PE=3 SV=1 55 516 6.0E-15
sp|Q92F47|SYK_LISIN Lysine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lysS PE=3 SV=1 23 516 6.0E-15
sp|Q724I4|SYK_LISMF Lysine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=lysS PE=3 SV=1 23 516 8.0E-15
sp|B2UTL0|SYDND_HELPS Aspartate--tRNA(Asp/Asn) ligase OS=Helicobacter pylori (strain Shi470) GN=aspS PE=3 SV=1 49 517 1.0E-14
sp|C4K4U5|SYD_HAMD5 Aspartate--tRNA ligase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=aspS PE=3 SV=1 38 517 1.0E-14
sp|Q8PVP6|SYK2_METMA Lysine--tRNA ligase 2 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=lysS2 PE=3 SV=1 23 517 1.0E-14
sp|A6U7M8|SYDND_SINMW Aspartate--tRNA(Asp/Asn) ligase OS=Sinorhizobium medicae (strain WSM419) GN=aspS PE=3 SV=1 38 516 1.0E-14
sp|Q65UP5|SYD_MANSM Aspartate--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=aspS PE=3 SV=1 55 517 1.0E-14
sp|Q1CTQ7|SYDND_HELPH Aspartate--tRNA(Asp/Asn) ligase OS=Helicobacter pylori (strain HPAG1) GN=aspS PE=3 SV=1 49 517 2.0E-14
sp|A6VQA9|SYD_ACTSZ Aspartate--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=aspS PE=3 SV=1 55 517 2.0E-14
sp|A5EIE6|SYDND_BRASB Aspartate--tRNA(Asp/Asn) ligase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=aspS PE=3 SV=1 38 321 2.0E-14
sp|A6SXF3|SYK_JANMA Lysine--tRNA ligase OS=Janthinobacterium sp. (strain Marseille) GN=lysS PE=3 SV=1 18 523 4.0E-14
sp|Q89MP9|SYDND_BRADU Aspartate--tRNA(Asp/Asn) ligase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=aspS PE=3 SV=1 38 321 4.0E-14
sp|C3M9G8|SYDND_RHISN Aspartate--tRNA(Asp/Asn) ligase OS=Rhizobium sp. (strain NGR234) GN=aspS PE=3 SV=1 38 321 5.0E-14
sp|A5WFG0|SYK_PSYWF Lysine--tRNA ligase OS=Psychrobacter sp. (strain PRwf-1) GN=lysS PE=3 SV=1 176 516 5.0E-14
sp|Q9SW96|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana GN=SYNC1 PE=1 SV=1 55 213 6.0E-14
sp|B2SXV7|SYK_BURPP Lysine--tRNA ligase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=lysS PE=3 SV=1 167 523 6.0E-14
sp|Q8TSN5|SYK2_METAC Lysine--tRNA ligase 2 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=lysS2 PE=3 SV=1 23 517 8.0E-14
sp|B3R478|SYK_CUPTR Lysine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=lysS PE=3 SV=1 20 516 1.0E-13
sp|Q72R38|SYK_LEPIC Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=lysS PE=3 SV=1 177 516 1.0E-13
sp|Q0I3S3|SYD_HAES1 Aspartate--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=aspS PE=3 SV=1 55 517 1.0E-13
sp|A4YTC4|SYDND_BRASO Aspartate--tRNA(Asp/Asn) ligase OS=Bradyrhizobium sp. (strain ORS278) GN=aspS PE=3 SV=1 38 321 1.0E-13
sp|Q8F4P5|SYK_LEPIN Lysine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=lysS PE=3 SV=1 177 516 1.0E-13
sp|Q1QAW5|SYK_PSYCK Lysine--tRNA ligase OS=Psychrobacter cryohalolentis (strain K5) GN=lysS PE=3 SV=1 176 516 1.0E-13
sp|Q5LUX6|SYDND_RUEPO Aspartate--tRNA(Asp/Asn) ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=aspS PE=3 SV=1 38 296 2.0E-13
sp|A6VPH6|SYK_ACTSZ Lysine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=lysS PE=3 SV=1 38 516 2.0E-13
sp|A3CY14|SYK_METMJ Lysine--tRNA ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=lysS PE=3 SV=1 146 517 2.0E-13
sp|Q4FSV2|SYK_PSYA2 Lysine--tRNA ligase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=lysS PE=3 SV=1 176 516 2.0E-13
sp|Q03E09|SYK_PEDPA Lysine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=lysS PE=3 SV=1 41 516 2.0E-13
sp|B3Q0S4|SYK_RHIE6 Lysine--tRNA ligase OS=Rhizobium etli (strain CIAT 652) GN=lysS PE=3 SV=1 30 523 5.0E-13
sp|Q473I5|SYK_CUPPJ Lysine--tRNA ligase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=lysS PE=3 SV=1 20 523 5.0E-13
sp|A8LI32|SYDND_DINSH Aspartate--tRNA(Asp/Asn) ligase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=aspS PE=3 SV=1 38 296 6.0E-13
sp|B5ZQW5|SYK_RHILW Lysine--tRNA ligase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=lysS PE=3 SV=1 30 523 6.0E-13
sp|Q57DZ8|SYDND_BRUAB Aspartate--tRNA(Asp/Asn) ligase OS=Brucella abortus biovar 1 (strain 9-941) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|Q2YNA7|SYDND_BRUA2 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella abortus (strain 2308) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|B2S501|SYDND_BRUA1 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella abortus (strain S19) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|Q82SH1|SYK_NITEU Lysine--tRNA ligase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=lysS PE=3 SV=1 176 517 8.0E-13
sp|Q7NC34|SYK_MYCGA Lysine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=lysS PE=3 SV=2 177 516 8.0E-13
sp|P67013|SYDND_BRUSU Aspartate--tRNA(Asp/Asn) ligase OS=Brucella suis biovar 1 (strain 1330) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|B0CL77|SYDND_BRUSI Aspartate--tRNA(Asp/Asn) ligase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|A5VPT5|SYDND_BRUO2 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|P67012|SYDND_BRUME Aspartate--tRNA(Asp/Asn) ligase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|C0RI89|SYDND_BRUMB Aspartate--tRNA(Asp/Asn) ligase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|A9MAD3|SYDND_BRUC2 Aspartate--tRNA(Asp/Asn) ligase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=aspS PE=3 SV=1 38 516 8.0E-13
sp|Q13WZ5|SYK_BURXL Lysine--tRNA ligase OS=Burkholderia xenovorans (strain LB400) GN=lysS PE=3 SV=1 167 523 9.0E-13
sp|Q0KCG3|SYK_CUPNH Lysine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=lysS PE=3 SV=1 20 523 1.0E-12
sp|Q2SXD6|SYK_BURTA Lysine--tRNA ligase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=lysS PE=1 SV=1 20 523 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0000166 nucleotide binding Yes
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0044281 small molecule metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0006520 cellular amino acid metabolic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1933
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1878 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7628
Ophiocordyceps camponoti-floridani Ophcf2|00562
Ophiocordyceps camponoti-rufipedis Ophun1|7491
Ophiocordyceps kimflemingae Ophio5|365
Ophiocordyceps subramaniannii Hirsu2|2068

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1878
MQRSPLTASWRRLPGPSSLCRRYSVRFPCQVQPCEPIHTVADLAASNLEADVPNVEVCGWVRSVRKSSNVRFVDI
SDGSSMRPVQAVVDKSLAVELRPGAAVRLSGTWCNLHKLSDALETPKTTTTHELRVQHVDVLGPSNPQTYPIQNK
YQTPESLRTIVHMRWRTPINSTLLRLRSDAISLVTRFFFRRKFQQTHPPIITSSDCEGAGEAFTLRAGTTDDFFR
QPKYLTVSSQLHLEAQAQAVGNVWCLSPTFRAEKSDTCRHLSEFYMLEAEMSFVQDMQHVMDLVQQIMADLAQGL
EKLSAATELRQNRLDSRNPAETLAFADLVGAQELRRRWQGLVYPSRWPRITYTEAIERLQSVASKFEHQPVWGES
LQSEHEKWLAEEIGRDETGDSLLPVFITHFPRTLKAFYMLRSSSPTAAGETVDCFDLVVPGLGELAGGSMREHRL
SELEDNMRLHGLRVPANSDNDENALAWYLDLRRWGCPPHGGFGLGFDRLLSYLSGVPNVRDVVPFPRHYGRCDC*
Coding >OphauG2|1878
ATGCAGCGCTCTCCACTGACGGCTTCATGGCGCCGTCTCCCCGGCCCGTCCTCGCTGTGCCGTCGCTACTCAGTG
CGCTTTCCATGCCAGGTCCAGCCATGCGAGCCGATACACACCGTGGCCGACCTGGCTGCGTCTAATCTCGAGGCC
GATGTGCCCAATGTCGAGGTGTGTGGCTGGGTCCGATCCGTCAGGAAGAGCTCCAATGTCCGCTTCGTCGACATT
AGCGACGGCTCGTCGATGCGCCCCGTCCAGGCCGTCGTGGACAAGTCTCTAGCTGTAGAACTGCGCCCGGGAGCT
GCCGTGCGTCTCTCCGGCACCTGGTGCAATCTCCACAAGCTGTCTGATGCGCTCGAGACGCCAAAGACGACAACG
ACCCATGAGCTGCGTGTCCAACATGTCGACGTGCTGGGCCCCTCGAATCCTCAGACGTATCCCATCCAGAACAAG
TACCAGACGCCAGAGAGCCTGCGCACCATTGTCCACATGCGCTGGCGCACTCCAATCAACTCCACCCTGCTTCGT
CTGCGTTCGGATGCCATTTCCCTCGTCACCCGCTTCTTCTTCCGCCGCAAGTTCCAGCAGACACACCCCCCCATC
ATTACCTCCTCCGACTGCGAGGGAGCTGGCGAGGCATTTACCCTCAGGGCCGGTACCACAGACGACTTCTTCCGC
CAGCCAAAGTACCTCACTGTCTCGAGCCAGCTGCACCTCGAGGCTCAGGCCCAGGCCGTGGGCAACGTCTGGTGC
CTATCGCCCACGTTTCGAGCGGAAAAGAGCGACACTTGCCGCCACCTGAGCGAGTTTTACATGCTCGAGGCCGAA
ATGAGCTTTGTCCAAGACATGCAACATGTAATGGACCTGGTGCAGCAAATCATGGCCGACCTGGCCCAGGGACTG
GAAAAGCTCAGCGCCGCAACCGAGCTCCGGCAGAACCGCCTCGACTCGCGCAACCCTGCCGAGACTCTAGCCTTT
GCCGACCTCGTCGGTGCGCAGGAGCTACGGCGACGCTGGCAAGGTCTCGTCTATCCATCCCGCTGGCCTCGCATC
ACATATACAGAAGCAATAGAGAGGCTGCAGTCGGTCGCCTCCAAGTTTGAGCACCAGCCCGTCTGGGGAGAGAGC
TTGCAATCCGAACACGAGAAGTGGTTGGCTGAAGAAATAGGGCGCGACGAAACAGGCGACTCTCTTTTACCAGTC
TTCATCACCCATTTCCCACGCACCCTCAAGGCATTTTATATGCTGCGGTCCAGCTCACCCACAGCTGCAGGAGAG
ACTGTCGACTGCTTTGATCTCGTTGTTCCGGGCCTTGGGGAGCTGGCGGGTGGCTCCATGCGCGAGCACAGGCTT
TCGGAGCTCGAGGACAACATGCGCCTCCACGGGCTTCGCGTCCCGGCCAATTCGGACAATGATGAAAACGCATTG
GCTTGGTATCTCGATCTCAGACGCTGGGGCTGTCCCCCTCACGGCGGGTTCGGCCTTGGCTTTGATCGGCTCTTG
AGCTATCTCTCCGGCGTACCCAACGTTCGCGACGTGGTGCCCTTTCCACGACATTATGGGCGCTGTGATTGCTAA
Transcript >OphauG2|1878
ATGCAGCGCTCTCCACTGACGGCTTCATGGCGCCGTCTCCCCGGCCCGTCCTCGCTGTGCCGTCGCTACTCAGTG
CGCTTTCCATGCCAGGTCCAGCCATGCGAGCCGATACACACCGTGGCCGACCTGGCTGCGTCTAATCTCGAGGCC
GATGTGCCCAATGTCGAGGTGTGTGGCTGGGTCCGATCCGTCAGGAAGAGCTCCAATGTCCGCTTCGTCGACATT
AGCGACGGCTCGTCGATGCGCCCCGTCCAGGCCGTCGTGGACAAGTCTCTAGCTGTAGAACTGCGCCCGGGAGCT
GCCGTGCGTCTCTCCGGCACCTGGTGCAATCTCCACAAGCTGTCTGATGCGCTCGAGACGCCAAAGACGACAACG
ACCCATGAGCTGCGTGTCCAACATGTCGACGTGCTGGGCCCCTCGAATCCTCAGACGTATCCCATCCAGAACAAG
TACCAGACGCCAGAGAGCCTGCGCACCATTGTCCACATGCGCTGGCGCACTCCAATCAACTCCACCCTGCTTCGT
CTGCGTTCGGATGCCATTTCCCTCGTCACCCGCTTCTTCTTCCGCCGCAAGTTCCAGCAGACACACCCCCCCATC
ATTACCTCCTCCGACTGCGAGGGAGCTGGCGAGGCATTTACCCTCAGGGCCGGTACCACAGACGACTTCTTCCGC
CAGCCAAAGTACCTCACTGTCTCGAGCCAGCTGCACCTCGAGGCTCAGGCCCAGGCCGTGGGCAACGTCTGGTGC
CTATCGCCCACGTTTCGAGCGGAAAAGAGCGACACTTGCCGCCACCTGAGCGAGTTTTACATGCTCGAGGCCGAA
ATGAGCTTTGTCCAAGACATGCAACATGTAATGGACCTGGTGCAGCAAATCATGGCCGACCTGGCCCAGGGACTG
GAAAAGCTCAGCGCCGCAACCGAGCTCCGGCAGAACCGCCTCGACTCGCGCAACCCTGCCGAGACTCTAGCCTTT
GCCGACCTCGTCGGTGCGCAGGAGCTACGGCGACGCTGGCAAGGTCTCGTCTATCCATCCCGCTGGCCTCGCATC
ACATATACAGAAGCAATAGAGAGGCTGCAGTCGGTCGCCTCCAAGTTTGAGCACCAGCCCGTCTGGGGAGAGAGC
TTGCAATCCGAACACGAGAAGTGGTTGGCTGAAGAAATAGGGCGCGACGAAACAGGCGACTCTCTTTTACCAGTC
TTCATCACCCATTTCCCACGCACCCTCAAGGCATTTTATATGCTGCGGTCCAGCTCACCCACAGCTGCAGGAGAG
ACTGTCGACTGCTTTGATCTCGTTGTTCCGGGCCTTGGGGAGCTGGCGGGTGGCTCCATGCGCGAGCACAGGCTT
TCGGAGCTCGAGGACAACATGCGCCTCCACGGGCTTCGCGTCCCGGCCAATTCGGACAATGATGAAAACGCATTG
GCTTGGTATCTCGATCTCAGACGCTGGGGCTGTCCCCCTCACGGCGGGTTCGGCCTTGGCTTTGATCGGCTCTTG
AGCTATCTCTCCGGCGTACCCAACGTTCGCGACGTGGTGCCCTTTCCACGACATTATGGGCGCTGTGATTGCTAA
Gene >OphauG2|1878
ATGCAGCGCTCTCCACTGACGGCTTCATGGCGCCGTCTCCCCGGCCCGTCCTCGCTGTGCCGTCGCTACTCAGTG
CGCTTTCCATGCCAGGTCCAGCCATGCGAGCCGATACACACCGTGGCCGACCTGGCTGCGTCTAATCTCGAGGCC
GATGTGCCCAATGTCGAGGTGTGTGGCTGGGTCCGATCCGTCAGGAAGAGCTCCAATGTCCGCTTCGTCGACATT
AGCGACGGCTCGTCGATGCGCCCCGTCCAGGCCGTCGTGGACAAGTCTCTAGCTGTAGAGTGCGTTGCTTGTCTT
GCAACTCGTCCTGGCCAATGCTACATCGTCGACACGGCCATGCTGATGCTTGCCATGTGCTTAGACTGCGCCCGG
GAGCTGCCGTGCGTCTCTCCGGCACCTGGTGCAATCTCCACAAGCTGTCTGATGCGCTCGAGACGCCAAAGACGA
CAACGACCCATGAGCTGCGTGTCCAACATGTCGACGTGCTGGGCCCCTCGAATCCTCAGGTGAGCCTGGCATCGC
TTGCCCATGGCCACCCCGGCTGACGCCCGCCAAGACGTATCCCATCCAGAACAAGTACCAGACGCCAGAGAGCCT
GCGCACCATTGTCCACATGCGCTGGCGCACTCCAATCAACTCCACCCTGCTTCGTCTGCGTTCGGATGCCATTTC
CCTCGTCACCCGCTTCTTCTTCCGCCGCAAGTTCCAGCAGACACACCCCCCCATCATTACCTCCTCCGACTGCGA
GGGAGCTGGCGAGGCATTTACCCTCAGGGCCGGTACCACAGACGACTTCTTCCGCCAGCCAAAGTACCTCACTGT
CTCGAGCCAGCTGCACCTCGAGGCTCAGGCCCAGGCCGTGGGCAACGTCTGGTGCCTATCGCCCACGTTTCGAGC
GGAAAAGAGCGACACTTGCCGCCACCTGAGCGAGTTTTACATGCTCGAGGCCGAAATGAGCTTTGTCCAAGACAT
GCAACATGTAATGGACCTGGTGCAGCAAATCATGGCCGACCTGGCCCAGGGACTGGAAAAGCTCAGCGCCGCAAC
CGAGCTCCGGCAGAACCGCCTCGACTCGCGCAACCCTGCCGAGACTCTAGCCTTTGCCGACCTCGTCGGTGCGCA
GGAGCTACGGCGACGCTGGCAAGGTCTCGTCTATCCATCCCGCTGGCCTCGCATCACATATACAGAAGCAATAGA
GAGGCTGCAGTCGGTCGCCTCCAAGTTTGAGCACCAGCCCGTCTGGGGAGAGAGCTTGCAATCCGAACACGAGAA
GTGGTTGGCTGAAGAAATAGGGCGCGACGAAACAGGCGACTCTCTTTTACCAGTCTTCATCACCCATTTCCCACG
CACCCTCAAGGCATTTTATATGCTGCGGTCCAGCTCACCCACAGCTGCAGGAGAGACTGTCGACTGCTTTGATCT
CGTTGTTCCGGGCCTTGGGGAGCTGGCGGGTGGCTCCATGCGCGAGCACAGGCTTTCGGAGCTCGAGGACAACAT
GCGCCTCCACGGGCTTCGCGTCCCGGCCAATTCGGACAATGATGAAAACGCATTGGCTTGGTATCTCGATCTCAG
ACGCTGGGGCTGTCCCCCTCACGGCGGGTTCGGCCTTGGCTTTGATCGGCTCTTGAGCTATCTCTCCGGCGTACC
CAACGTTCGCGACGTGGTGCCCTTTCCACGACATTATGGGCGCTGTGATTGCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail