Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1876
Gene name
LocationContig_160:31..1072
Strand-
Gene length (bp)1041
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03747 ADP_ribosyl_GH ADP-ribosylglycohydrolase 6.5E-62 22 323

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P14300|DRAG_RHORU ADP-ribosyl-[dinitrogen reductase] glycohydrolase OS=Rhodospirillum rubrum GN=draG PE=1 SV=1 17 334 3.0E-18
sp|Q5UQA6|ADPRM_MIMIV Putative ADP-ribosyl glycohydrolase L543 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L543 PE=3 SV=1 19 325 8.0E-16
sp|Q58588|Y1187_METJA Uncharacterized protein MJ1187 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1187 PE=1 SV=1 13 330 5.0E-11
sp|Q5ZI51|ARHL2_CHICK Poly(ADP-ribose) glycohydrolase ARH3 OS=Gallus gallus GN=ADPRHL2 PE=2 SV=1 18 338 7.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1876
MCHQGMTVASHAMTIRQSRVLGAMLGLHAGDSLGATLEFDTHEEIKAKYPDGLQDIIGGGTFDWPAGHATDDTDM
ARAVMLAYRERTGPEDDVARRAAEWFLRWKQGIDWPDRQPGSTPKDIGLATAVGLDRYAETRDPDQAGAGVNQAG
NGSLMRCLATGLWQGDAEKRRHESIRISAVTHNDARCTVSCAVYNAMVARLVSLPAKTSASEAATVALVEAEAEA
ERLEADSPTKPVLRALGQGMQLSVEELARNGPQKGSLPGKARGYVLETLALAVAALRDERPLRDVLVDVVRVGGD
TDTNAAVAGGLLGARDGHEAIPEAWSEKLQFGSEFRQLMLDMVSED*
Coding >OphauG2|1876
ATGTGTCACCAGGGCATGACGGTGGCGTCGCATGCCATGACGATACGGCAGTCACGAGTGCTGGGGGCGATGCTG
GGTCTACACGCGGGCGACAGCCTGGGCGCGACGCTCGAGTTTGACACACACGAGGAGATCAAGGCCAAGTACCCC
GATGGACTGCAAGACATTATTGGCGGCGGCACCTTTGACTGGCCGGCAGGACACGCCACCGACGACACGGACATG
GCGCGGGCGGTGATGCTTGCATACCGGGAGCGAACGGGGCCAGAAGACGACGTGGCGCGACGGGCAGCCGAGTGG
TTTCTGCGGTGGAAGCAGGGCATCGACTGGCCGGACCGGCAGCCGGGGTCGACGCCCAAGGACATTGGGCTGGCG
ACGGCGGTGGGGCTGGATCGCTACGCCGAGACGCGCGACCCGGACCAGGCGGGGGCGGGAGTCAACCAGGCGGGC
AACGGGAGTCTGATGCGCTGCCTGGCGACGGGGCTATGGCAGGGCGACGCGGAGAAGCGTCGGCACGAGAGCATA
CGCATCAGCGCCGTGACGCACAACGACGCGCGCTGCACGGTTTCGTGTGCCGTGTACAATGCCATGGTGGCGCGC
CTGGTGAGTCTGCCGGCCAAGACGAGCGCGAGCGAGGCAGCGACGGTGGCGCTGGTAGAGGCCGAGGCCGAGGCG
GAGCGGCTCGAGGCCGACTCGCCCACCAAGCCGGTGCTGAGGGCCCTTGGCCAAGGCATGCAGCTCTCTGTGGAA
GAGCTAGCGCGCAACGGGCCACAAAAGGGCAGTTTGCCCGGCAAGGCGAGGGGATACGTGCTCGAGACGCTGGCG
CTGGCTGTGGCGGCCTTGCGGGACGAGCGGCCGCTGCGTGACGTGCTGGTCGATGTCGTGCGAGTGGGCGGCGAC
ACGGATACCAATGCAGCCGTGGCGGGAGGCCTGCTGGGGGCGCGCGACGGTCACGAAGCCATTCCAGAGGCCTGG
TCGGAGAAGCTCCAGTTTGGAAGCGAGTTTCGCCAGCTGATGCTGGACATGGTGTCTGAAGACTAG
Transcript >OphauG2|1876
ATGTGTCACCAGGGCATGACGGTGGCGTCGCATGCCATGACGATACGGCAGTCACGAGTGCTGGGGGCGATGCTG
GGTCTACACGCGGGCGACAGCCTGGGCGCGACGCTCGAGTTTGACACACACGAGGAGATCAAGGCCAAGTACCCC
GATGGACTGCAAGACATTATTGGCGGCGGCACCTTTGACTGGCCGGCAGGACACGCCACCGACGACACGGACATG
GCGCGGGCGGTGATGCTTGCATACCGGGAGCGAACGGGGCCAGAAGACGACGTGGCGCGACGGGCAGCCGAGTGG
TTTCTGCGGTGGAAGCAGGGCATCGACTGGCCGGACCGGCAGCCGGGGTCGACGCCCAAGGACATTGGGCTGGCG
ACGGCGGTGGGGCTGGATCGCTACGCCGAGACGCGCGACCCGGACCAGGCGGGGGCGGGAGTCAACCAGGCGGGC
AACGGGAGTCTGATGCGCTGCCTGGCGACGGGGCTATGGCAGGGCGACGCGGAGAAGCGTCGGCACGAGAGCATA
CGCATCAGCGCCGTGACGCACAACGACGCGCGCTGCACGGTTTCGTGTGCCGTGTACAATGCCATGGTGGCGCGC
CTGGTGAGTCTGCCGGCCAAGACGAGCGCGAGCGAGGCAGCGACGGTGGCGCTGGTAGAGGCCGAGGCCGAGGCG
GAGCGGCTCGAGGCCGACTCGCCCACCAAGCCGGTGCTGAGGGCCCTTGGCCAAGGCATGCAGCTCTCTGTGGAA
GAGCTAGCGCGCAACGGGCCACAAAAGGGCAGTTTGCCCGGCAAGGCGAGGGGATACGTGCTCGAGACGCTGGCG
CTGGCTGTGGCGGCCTTGCGGGACGAGCGGCCGCTGCGTGACGTGCTGGTCGATGTCGTGCGAGTGGGCGGCGAC
ACGGATACCAATGCAGCCGTGGCGGGAGGCCTGCTGGGGGCGCGCGACGGTCACGAAGCCATTCCAGAGGCCTGG
TCGGAGAAGCTCCAGTTTGGAAGCGAGTTTCGCCAGCTGATGCTGGACATGGTGTCTGAAGACTAG
Gene >OphauG2|1876
ATGTGTCACCAGGGCATGACGGTGGCGTCGCATGCCATGACGATACGGCAGTCACGAGTGCTGGGGGCGATGCTG
GGTCTACACGCGGGCGACAGCCTGGGCGCGACGCTCGAGTTTGACACACACGAGGAGATCAAGGCCAAGTACCCC
GATGGACTGCAAGACATTATTGGCGGCGGCACCTTTGACTGGCCGGCAGGACACGCCACCGACGACACGGACATG
GCGCGGGCGGTGATGCTTGCATACCGGGAGCGAACGGGGCCAGAAGACGACGTGGCGCGACGGGCAGCCGAGTGG
TTTCTGCGGTGGAAGCAGGGCATCGACTGGCCGGACCGGCAGCCGGGGTCGACGCCCAAGGACATTGGGCTGGCG
ACGGCGGTGGGGCTGGATCGCTACGCCGAGACGCGCGACCCGGACCAGGCGGGGGCGGGAGTCAACCAGGCGGGC
AACGGGAGTCTGATGCGCTGCCTGGCGACGGGGCTATGGCAGGGCGACGCGGAGAAGCGTCGGCACGAGAGCATA
CGCATCAGCGCCGTGACGCACAACGACGCGCGCTGCACGGTTTCGTGTGCCGTGTACAATGCCATGGTGGCGCGC
CTGGTGAGTCTGCCGGCCAAGACGAGCGCGAGCGAGGCAGCGACGGTGGCGCTGGTAGAGGCCGAGGCCGAGGCG
GAGCGGCTCGAGGCCGACTCGCCCACCAAGCCGGTGCTGAGGGCCCTTGGCCAAGGCATGCAGCTCTCTGTGGAA
GAGCTAGCGCGCAACGGGCCACAAAAGGGCAGTTTGCCCGGCAAGGCGAGGGGATACGTGCTCGAGACGCTGGCG
CTGGCTGTGGCGGCCTTGCGGGACGAGCGGCCGCTGCGTGACGTGCTGGTCGATGTCGTGCGAGTGGGCGGCGAC
ACGGATACCAATGCAGCCGTGGCGGGAGGCCTGCTGGGGGCGCGCGACGGTCACGAAGCCATTCCAGAGGCCTGG
TCGGAGAAGCTCCAGTTTGGAAGCGAGTTTCGCCAGCTGATGCTGGACATGGTGTCTGAAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail