Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1871
Gene name
LocationContig_16:40953..42590
Strand-
Gene length (bp)1637
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00984 UDPG_MGDP_dh UDP-glucose/GDP-mannose dehydrogenase family, central domain 9.9E-20 237 309
PF03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain 1.8E-14 59 209
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 2.7E-04 59 178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 42 432 6.0E-51
sp|P39861|CAPL_STAAU Protein CapL OS=Staphylococcus aureus GN=capL PE=3 SV=1 59 376 2.0E-36
sp|Q04972|VIPA_SALTI Vi polysaccharide biosynthesis protein VipA/TviB OS=Salmonella typhi GN=vipA PE=3 SV=1 59 396 6.0E-34
sp|Q6LZC3|WECC_METMP UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecC PE=1 SV=1 59 397 2.0E-30
sp|A4FY94|WECC_METM5 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=wecC PE=3 SV=1 59 389 5.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G3XD94|UGND_PSEAE UDP-N-acetyl-D-glucosamine 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=wbpA PE=1 SV=1 42 432 6.0E-51
sp|P39861|CAPL_STAAU Protein CapL OS=Staphylococcus aureus GN=capL PE=3 SV=1 59 376 2.0E-36
sp|Q04972|VIPA_SALTI Vi polysaccharide biosynthesis protein VipA/TviB OS=Salmonella typhi GN=vipA PE=3 SV=1 59 396 6.0E-34
sp|Q6LZC3|WECC_METMP UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain S2 / LL) GN=wecC PE=1 SV=1 59 397 2.0E-30
sp|A4FY94|WECC_METM5 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=wecC PE=3 SV=1 59 389 5.0E-30
sp|A6VK13|WECC_METM7 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=wecC PE=3 SV=1 59 389 6.0E-29
sp|Q57871|WECC_METJA UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=wecC PE=3 SV=1 59 309 1.0E-26
sp|A6USK4|WECC_METVS UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=wecC PE=3 SV=1 52 389 2.0E-26
sp|Q45410|EPSD_RALSL NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum GN=epsD PE=3 SV=1 59 400 5.0E-26
sp|Q8Z389|WECC_SALTI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhi GN=wecC PE=3 SV=1 59 404 1.0E-25
sp|P58591|EPSD_RALSO NDP-N-acetyl-D-galactosaminuronic acid dehydrogenase OS=Ralstonia solanacearum (strain GMI1000) GN=epsD PE=3 SV=1 47 434 1.0E-25
sp|Q9L6R4|WECC_SALTY UDP-N-acetyl-D-mannosamine dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=wecC PE=3 SV=1 59 404 1.0E-25
sp|P67067|WECC_SHIFL UDP-N-acetyl-D-mannosamine dehydrogenase OS=Shigella flexneri GN=wecC PE=3 SV=1 59 401 4.0E-24
sp|P27829|WECC_ECOLI UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli (strain K12) GN=wecC PE=1 SV=4 59 401 4.0E-24
sp|P67066|WECC_ECO57 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Escherichia coli O157:H7 GN=wecC PE=3 SV=1 59 401 4.0E-24
sp|A6UU98|WECC_META3 UDP-N-acetyl-D-mannosamine dehydrogenase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=wecC PE=3 SV=1 59 397 5.0E-24
sp|Q8ZAE4|WECC_YERPE UDP-N-acetyl-D-mannosamine dehydrogenase OS=Yersinia pestis GN=wecC PE=3 SV=1 59 309 3.0E-23
sp|D4GYH5|AGLM_HALVD UDP-glucose 6-dehydrogenase AglM OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglM PE=1 SV=1 59 400 2.0E-15
sp|Q47329|UDG5_ECOLX UDP-glucose 6-dehydrogenase OS=Escherichia coli GN=kfiD PE=3 SV=1 59 400 5.0E-12
sp|P51585|ALGD_AZOVI GDP-mannose 6-dehydrogenase OS=Azotobacter vinelandii GN=algD PE=3 SV=1 59 376 7.0E-12
sp|Q88NC4|ALGD_PSEPK GDP-mannose 6-dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=algD PE=3 SV=1 59 376 1.0E-11
sp|O32271|TUAD_BACSU UDP-glucose 6-dehydrogenase TuaD OS=Bacillus subtilis (strain 168) GN=tuaD PE=1 SV=1 59 376 1.0E-10
sp|O86422|UDG_PSEAE UDP-glucose 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=udg PE=3 SV=2 59 400 5.0E-10
sp|P11759|ALGD_PSEAE GDP-mannose 6-dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=algD PE=1 SV=2 59 376 8.0E-09
sp|Q04873|UDG_SALTY UDP-glucose 6-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=udg PE=3 SV=1 59 394 3.0E-08
sp|Q4UK39|UDG_RICFE UDP-glucose 6-dehydrogenase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=udg PE=3 SV=1 58 420 4.0E-08
sp|Q04872|UDG_ECO11 UDP-glucose 6-dehydrogenase OS=Escherichia coli O111:H- GN=ugd PE=3 SV=1 59 341 4.0E-08
sp|Q92GB1|UDG_RICCN UDP-glucose 6-dehydrogenase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=udg PE=3 SV=1 58 390 1.0E-07
sp|Q68VX0|UDG_RICTY UDP-glucose 6-dehydrogenase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=udg PE=3 SV=1 59 390 1.0E-07
sp|O33952|UDG8_ECOLX UDP-glucose 6-dehydrogenase OS=Escherichia coli GN=ugd PE=3 SV=1 59 394 2.0E-07
sp|O34862|YTCA_BACSU Putative UDP-glucose 6-dehydrogenase YtcA OS=Bacillus subtilis (strain 168) GN=ytcA PE=3 SV=1 59 376 5.0E-07
sp|O05973|UDG_RICPR UDP-glucose 6-dehydrogenase OS=Rickettsia prowazekii (strain Madrid E) GN=udg PE=3 SV=1 58 420 6.0E-07
sp|Q75GS4|UGDH1_ORYSJ UDP-glucose 6-dehydrogenase 1 OS=Oryza sativa subsp. japonica GN=UGD1 PE=3 SV=1 127 398 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor Yes
GO:0050661 NADP binding Yes
GO:0051287 NAD binding Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup484
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1871 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7347
Ophiocordyceps camponoti-floridani Ophcf2|05776
Ophiocordyceps camponoti-rufipedis Ophun1|1148
Ophiocordyceps kimflemingae Ophio5|5242
Ophiocordyceps subramaniannii Hirsu2|10824
Ophiocordyceps subramaniannii Hirsu2|8429
Ophiocordyceps subramaniannii Hirsu2|9170

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1871
MVAKPSPLRLDTSLLDYKPDAFSNGGLPVTPPADYELEVLHELSTPVDEVIDPQARPLVAVIGVGYVGTHLVNNF
GRVHDTIGFDVSERRVKELQHEFSQNSRVRVTSNASDLDEATHYLISVPTLLLADRSIDASYLRSALRTVAAHAR
RGATVVIESSVAVGMTRQLLGPLAKRHGYFAGMSPERVDPGRIDPPAHAIPKVVSGLDDVVPGSLNSILALYSQA
FDRVVPVSTPEVAEMTKLYENCQRMMCIAYANEMADACQPHGIDPFEVCSAAATKPFGYQDYTPGVGVGGHCIPV
NPHYLLSNSAFPLLQAASDAMARRPAALARRAVDKLLRRWPANAVCKPRVLVVGVGFKAGQATLSNSPGLDLIKH
LCLSSSVDVGFADPLVSQDHVPQVPRLDDDAWNAETLKSFDMIIVTMRQHGLDFGLLDNLDGVEVEFWCK*
Coding >OphauG2|1871
ATGGTAGCCAAGCCCAGCCCCCTGAGGCTGGACACGAGCCTATTAGATTACAAGCCCGACGCTTTCAGCAACGGG
GGCTTGCCCGTCACTCCACCCGCAGACTATGAGCTTGAGGTGCTGCACGAGCTGTCGACGCCTGTTGATGAGGTC
ATTGACCCTCAGGCCCGGCCGCTGGTGGCGGTGATTGGGGTTGGCTACGTGGGCACGCACCTGGTAAACAACTTT
GGCCGCGTCCACGACACCATTGGCTTTGATGTTTCGGAGCGGCGCGTCAAGGAGCTACAGCATGAGTTTAGCCAA
AACAGCCGTGTTCGGGTGACGAGCAACGCCAGTGACCTGGACGAGGCCACCCACTATTTGATTTCCGTGCCGACT
CTGCTGCTCGCAGACCGAAGCATTGATGCCTCGTATCTGCGCAGCGCCCTCAGGACCGTGGCCGCACATGCCCGC
CGCGGCGCCACGGTGGTGATTGAGAGCTCGGTGGCTGTTGGCATGACGAGACAGCTGCTGGGGCCCTTGGCGAAG
CGGCACGGCTATTTTGCAGGAATGTCTCCCGAGCGAGTCGACCCCGGCCGCATAGACCCTCCAGCCCATGCCATC
CCAAAAGTAGTGTCCGGCCTGGACGACGTGGTTCCCGGGTCCCTCAACAGCATCCTGGCCCTCTACTCACAGGCC
TTTGACCGCGTGGTGCCCGTGTCCACGCCCGAGGTGGCCGAGATGACCAAGCTGTATGAAAACTGCCAGCGCATG
ATGTGCATTGCCTACGCCAACGAAATGGCCGATGCCTGTCAGCCGCACGGCATCGACCCCTTTGAGGTCTGTTCC
GCCGCCGCCACAAAGCCCTTTGGCTACCAAGATTACACGCCTGGCGTTGGCGTCGGCGGCCACTGTATCCCCGTC
AACCCTCACTACCTGCTCTCCAACAGCGCCTTTCCCTTGCTCCAGGCCGCCAGCGACGCCATGGCCCGCCGTCCT
GCTGCTCTGGCCCGCCGTGCTGTCGACAAGCTGCTGCGCCGCTGGCCTGCAAACGCCGTCTGCAAGCCCCGTGTC
CTCGTCGTTGGCGTCGGCTTCAAGGCAGGCCAGGCCACCCTGAGCAACTCGCCTGGCTTGGACCTCATCAAGCAT
CTCTGTCTGTCGAGCAGCGTGGATGTTGGTTTTGCTGATCCGCTCGTCTCCCAAGACCATGTGCCTCAGGTCCCG
CGTTTGGACGACGACGCCTGGAACGCAGAGACTTTAAAGTCTTTTGATATGATTATTGTTACTATGCGCCAACAT
GGACTCGACTTTGGCCTCCTCGACAACTTGGACGGCGTAGAGGTTGAGTTTTGGTGCAAGTGA
Transcript >OphauG2|1871
ATGGTAGCCAAGCCCAGCCCCCTGAGGCTGGACACGAGCCTATTAGATTACAAGCCCGACGCTTTCAGCAACGGG
GGCTTGCCCGTCACTCCACCCGCAGACTATGAGCTTGAGGTGCTGCACGAGCTGTCGACGCCTGTTGATGAGGTC
ATTGACCCTCAGGCCCGGCCGCTGGTGGCGGTGATTGGGGTTGGCTACGTGGGCACGCACCTGGTAAACAACTTT
GGCCGCGTCCACGACACCATTGGCTTTGATGTTTCGGAGCGGCGCGTCAAGGAGCTACAGCATGAGTTTAGCCAA
AACAGCCGTGTTCGGGTGACGAGCAACGCCAGTGACCTGGACGAGGCCACCCACTATTTGATTTCCGTGCCGACT
CTGCTGCTCGCAGACCGAAGCATTGATGCCTCGTATCTGCGCAGCGCCCTCAGGACCGTGGCCGCACATGCCCGC
CGCGGCGCCACGGTGGTGATTGAGAGCTCGGTGGCTGTTGGCATGACGAGACAGCTGCTGGGGCCCTTGGCGAAG
CGGCACGGCTATTTTGCAGGAATGTCTCCCGAGCGAGTCGACCCCGGCCGCATAGACCCTCCAGCCCATGCCATC
CCAAAAGTAGTGTCCGGCCTGGACGACGTGGTTCCCGGGTCCCTCAACAGCATCCTGGCCCTCTACTCACAGGCC
TTTGACCGCGTGGTGCCCGTGTCCACGCCCGAGGTGGCCGAGATGACCAAGCTGTATGAAAACTGCCAGCGCATG
ATGTGCATTGCCTACGCCAACGAAATGGCCGATGCCTGTCAGCCGCACGGCATCGACCCCTTTGAGGTCTGTTCC
GCCGCCGCCACAAAGCCCTTTGGCTACCAAGATTACACGCCTGGCGTTGGCGTCGGCGGCCACTGTATCCCCGTC
AACCCTCACTACCTGCTCTCCAACAGCGCCTTTCCCTTGCTCCAGGCCGCCAGCGACGCCATGGCCCGCCGTCCT
GCTGCTCTGGCCCGCCGTGCTGTCGACAAGCTGCTGCGCCGCTGGCCTGCAAACGCCGTCTGCAAGCCCCGTGTC
CTCGTCGTTGGCGTCGGCTTCAAGGCAGGCCAGGCCACCCTGAGCAACTCGCCTGGCTTGGACCTCATCAAGCAT
CTCTGTCTGTCGAGCAGCGTGGATGTTGGTTTTGCTGATCCGCTCGTCTCCCAAGACCATGTGCCTCAGGTCCCG
CGTTTGGACGACGACGCCTGGAACGCAGAGACTTTAAAGTCTTTTGATATGATTATTGTTACTATGCGCCAACAT
GGACTCGACTTTGGCCTCCTCGACAACTTGGACGGCGTAGAGGTTGAGTTTTGGTGCAAGTGA
Gene >OphauG2|1871
ATGGTAGCCAAGCCCAGCCCCCTGAGGCTGGACACGAGCCTATTAGATTACAAGCCCGACGCTTTCAGCAACGGG
GGCTTGCCCGTCACTCCACCCGCAGACTATGAGCTTGAGGTGCTGCACGAGCTGTCGACGCCTGTTGATGAGGTC
ATTGACCCTCAGGCCCGGCCGCTGGTGGCGGTGATTGGGGTTGGCTACGTGGGCACGCACCTGGTAAACAACTTT
GGCCGCGTCCACGACACCATTGGCTTTGATGTTTCGGAGCGGCGCGTCAAGGAGCTACAGCATGAGTTTAGCCAA
AACAGCCGTGTTCGGGTGACGAGCAACGCCAGTGACCTGGACGAGGCCACCCACTATTTGATTTCCGTGCCGACT
CTGCTGCTCGCAGACCGAAGCATTGATGCCTCGTATCTGCGCAGCGCCCTCAGGACCGTGGCCGCACATGCCCGC
CGCGGCGCCACGGTGGTGATTGAGAGCTCGGTGGCTGTTGGCATGACGAGACAGCTGCTGGGGCCCTTGGCGAAG
CGGCACGGCTATTTTGCAGGAATGTCTCCCGAGGTATGCCACGATGATTCCCTCTATCTATGCCTGTTCTACTCT
TGTCTGCTTCTATTCTATGTCTATTCTACTCTTGTCTGCCTCTATCCCGTCCCTATTCTACTCTCACCTGCCTCT
ATTCCATCCCTATTCTACTCTCACCTGCCTCTATTCCATCCCTATTCTACTCTCACCTGTCCCTATTCCATCCCT
ATTCTCCTCTCATCTGCCTCTATCCCATCCCTATCCTACTCACCTGTCCCTACTTCATCCCTATTCTGCCCTATT
CCATCCCTGTTCCAAGACTAAAGCCTCTCCAGCGAGTCGACCCCGGCCGCATAGACCCTCCAGCCCATGCCATCC
CAAAAGTAGTGTCCGGCCTGGACGACGTGGTTCCCGGGTCCCTCAACAGCATCCTGGCCCTCTACTCACAGGCCT
TTGACCGCGTGGTGCCCGTGTCCACGCCCGAGGTGGCCGAGATGACCAAGCTGTATGAAAACTGCCAGCGCATGA
TGTGCATTGCCTACGCCAACGAAATGGCCGATGCCTGTCAGCCGCACGGCATCGACCCCTTTGAGGTCTGTTCCG
CCGCCGCCACAAAGCCCTTTGGCTACCAAGATTACACGCCTGGCGTTGGCGTCGGCGGCCACTGTATCCCCGTCA
ACCCTCACTACCTGCTCTCCAACAGCGCCTTTCCCTTGCTCCAGGCCGCCAGCGACGCCATGGCCCGCCGTCCTG
CTGCTCTGGCCCGCCGTGCTGTCGACAAGCTGCTGCGCCGCTGGCCTGCAAACGCCGTCTGCAAGCCCCGTGTCC
TCGTCGTTGGCGTCGGCTTCAAGGCAGGCCAGGCCACCCTGAGCAACTCGCCTGGCTTGGACCTCATCAAGCATC
TCTGTCTGTCGAGCAGCGTGGATGTTGGTTTTGCTGATCCGCTCGTCTCCCAAGACCATGTGCCTCAGGTCCCGC
GTTTGGACGACGACGCCTGGAACGCAGAGACTTTAAAGTCTTTTGATATGATTATTGTTACTATGCGCCAACATG
GACTCGACTTTGGCCTCCTCGACAACTTGGACGGCGTAGAGGTTGAGTTTTGGTGCAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail